KEGG   Listeria monocytogenes SLCC7179 (serotype 3a): LMOSLCC7179_1506Help
Entry
LMOSLCC7179_1506  CDS       T02224                                 

Gene name
ruvA
Definition
(GenBank) holliday junction DNA helicase
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lmos  Listeria monocytogenes SLCC7179 (serotype 3a)
Pathway
lmos03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:lmos00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    LMOSLCC7179_1506 (ruvA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lmos03400]
    LMOSLCC7179_1506 (ruvA)
Enzymes [BR:lmos01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     LMOSLCC7179_1506 (ruvA)
DNA repair and recombination proteins [BR:lmos03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     LMOSLCC7179_1506 (ruvA)
    RecFOR pathway proteins
     LMOSLCC7179_1506 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N RuvA_C HHH_5 HHH UBA_6 WIYLD PRKCSH_1 DUF2642 IMS_HHH
Motif
Other DBs
NCBI-ProteinID: CBY60712
LinkDB All DBs
Position
complement(1515060..1515665)
Genome map
AA seq 201 aa AA seqDB search
MYDYIKGTVTTITPEYIVVEAGQIGYQIITGNPFSFQRLEGTEAQVFLYQHVREDNISLF
GFQTTEERYLFKKLLSVSGIGPKSALAIIASGDVVPLISAIESEDDVYLTKFPSVGKKTA
RQIILDLKGKLADVVASEIVYVAPENDMVAGLSPQLEEAVLALEALGYSTRELKKVIPKL
AKEADLTSDAYIKLALQLMTK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
ttgtacgattacataaaaggaaccgttacgacgattacacccgaatatattgttgttgag
gcaggacaaatcggctatcaaataattacagggaacccgttttcctttcaacgactagaa
ggtacagaagcgcaagtctttttgtatcagcatgtgagagaggataatatttctttattt
ggttttcaaacaacagaagaacgttatttattcaaaaaattattgagtgtttcgggcatt
ggaccaaaaagcgcactagccattattgcttcaggcgatgtcgttccactaatttcagcg
attgaatccgaagacgatgtttatttaaccaaatttccgagtgtcggtaaaaaaacagct
cgccaaattattcttgatttaaaaggaaaactggctgatgttgttgcgagcgaaattgtt
tatgttgccccagaaaacgatatggttgcgggactttccccgcaattagaagaggccgta
ttagctttagaagcgctcggttatagcacgcgagaacttaaaaaagtaataccaaaattg
gctaaagaagctgacttaacaagcgacgcatatatcaagctagcgctacaattaatgaca
aaatag

DBGET integrated database retrieval system