KEGG   Listeria monocytogenes SLCC7179 (serotype 3a): LMOSLCC7179_1793Help
Entry
LMOSLCC7179_1793  CDS       T02224                                 

Gene name
prkC
Definition
(GenBank) serine/threonine-protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
lmos  Listeria monocytogenes SLCC7179 (serotype 3a)
Brite
KEGG Orthology (KO) [BR:lmos00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lmos01001]
    LMOSLCC7179_1793 (prkC)
Enzymes [BR:lmos01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     LMOSLCC7179_1793 (prkC)
Protein kinases [BR:lmos01001]
 Serine/threonine kinases: Other
  Bacterial family
   LMOSLCC7179_1793 (prkC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr Haspin_kinase APH Kinase-like Kdo RIO1 Seadorna_VP7 YukC LPD29 DUF4448 ETRAMP
Motif
Other DBs
NCBI-ProteinID: CBY60999
LinkDB All DBs
Position
complement(1836700..1838667)
Genome map
AA seq 655 aa AA seqDB search
MMIGKRLSDRYKILHAIGGGGMANVYLAHDIILDRDVAVKILRIDLADESNLIRRFQREA
QSATSLVHPNIVSVYDVGEENDLHYIVMEHVDGMDLKQYIHENHPISYDKAVDIMLQIVS
AVAIAHQHHIIHRDLKPQNILIDHDGVVKITDFGIAMALSETSITQTNSLLGSVHYLSPE
QARGGMATQKSDIYSLGIVLYELLTGKVPFDGESAVSIAIKHLQADIPSARAQNPEIPQS
LENIIIKATAKDPFLRYQNAEEMEKDLQTCLNKDRLNEPKYVFPTDDGDTKAIPIIATKD
TMQNLDKTIVPEGKVAAAEVVPEEKKDKKKKKMSKKKKIALIVSSVIIIFIIGILLLWLL
GKSPDEVAVPDVSGKTEDQAVALLQKEGFVIGKTAEKNSDEVDEGKVINTDPEAGEMKEK
GTKINLFVSIGSKKITMDDYTGRSYTDTKALLEEQGFKNISSEEAYSSEIEKGLIISQTP
TQGTEVVAKSTDVKFVVSKGAEPITLKDLRGYTKTAVEDYASPLGLKVSSKEENSSTVEK
GQVISQSPSAGTAMNSGDTIEIVISAGPKEKQVKEVTKTFNIPYTPSDEENPQPQKIQIY
IQDKDHSMTSAYREMSITQNTSVEITFQIEEGSSAGYKIISDDKVIDEGTVPYPN
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgatgattggtaagcgattaagcgatcgatataagattttacatgcaataggcggcggc
ggaatggccaatgtgtatttggcacatgatattattcttgatagagatgttgcagtaaaa
attttacgaatcgatttagcagatgaaagcaaccttattcgtcgattccaacgggaagct
caatcagcaacgagtcttgttcaccctaatattgttagtgtgtacgatgttggtgaagaa
aatgatttacactatattgtaatggaacatgtggacggaatggatttaaaacagtatatt
cacgaaaatcacccaatcagttacgataaagcagtagatattatgcttcaaatcgtttct
gcggtggcaattgcccatcaacatcacattattcaccgtgatttaaaaccccagaatatt
ttaattgatcatgatggcgtagtgaaaattactgattttggcattgcgatggcactttca
gaaacatccattacacaaacgaattctttgttgggttcagtacattacttatccccagaa
caagcacgtggtggaatggctactcaaaaatcagacatctattcactaggaatcgtgcta
tatgaactattaactggaaaagttcctttcgacggtgagtctgcagtttctattgctatt
aagcatttgcaagcggatattccatctgcaagagcgcaaaatccagaaattccacaaagc
ttagaaaatattattattaaagcaacggcgaaagatccatttttacgttaccaaaacgcg
gaagaaatggaaaaagacttgcaaacttgtttaaataaagaccgtttgaacgagccaaaa
tatgttttcccaacagatgatggtgatacaaaagcaattccaatcatcgcaacaaaagat
acgatgcaaaaccttgataaaacgattgttccagaaggaaaagtagccgctgccgaagta
gttcctgaggagaaaaaagataagaaaaagaaaaaaatgagcaagaaaaagaaaattgct
ctcattgtttcttctgtcattatcatttttatcatcggtattttactactgtggctttta
ggcaagagccctgatgaagtcgctgtgccggacgtttctggtaaaacggaagaccaagca
gtggcgttacttcaaaaagaaggctttgtcataggtaaaacagcagaaaaaaatagtgat
gaagtagatgaggggaaagtaattaataccgacccagaagctggagaaatgaaagaaaaa
ggaacaaaaatcaatttattcgtaagcattggttctaaaaaaataaccatggatgactat
acaggaagaagttacacagatacaaaagctttacttgaagaacagggatttaaaaatatt
tcttcggaggaagcttatagttcagaaattgaaaaaggcttaattattagccaaacaccg
acacaaggaacagaagtagtcgctaaatcaacagatgtgaaattcgtcgtaagtaaaggt
gcagagccaattacactgaaagatttacgaggttatactaaaacagcagtagaagattat
gcttcaccacttgggctaaaagtttcaagtaaagaagagaactcaagtacagtggaaaaa
ggacaagttatttcacagtccccatcagctggaacagcaatgaactctggtgatacaatc
gagattgtcatttctgctggaccaaaagaaaaacaagtaaaagaagtaactaaaacattt
aacatcccttatacaccaagtgatgaagaaaacccacaaccacagaaaattcaaatctac
attcaagataaagaccatagcatgactagcgcttaccgagaaatgagcattacacaaaat
acctcggtagaaataactttccaaattgaagaaggttctagcgcaggctataaaattatc
agtgatgataaagtaatcgatgaaggtacagtcccttatccaaattaa

DBGET integrated database retrieval system