KEGG   Listeria monocytogenes SLCC7179 (serotype 3a): LMOSLCC7179_2115Help
Entry
LMOSLCC7179_2115  CDS       T02224                                 

Definition
(GenBank) ABC transporter, ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
lmos  Listeria monocytogenes SLCC7179 (serotype 3a)
Brite
KEGG Orthology (KO) [BR:lmos00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lmos02000]
    LMOSLCC7179_2115
Transporters [BR:lmos02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter
    LMOSLCC7179_2115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran DUF4162 AAA_21 AAA_15 AAA_22 TsaE SbcCD_C AAA_29 Zeta_toxin RsgA_GTPase AAA_30
Motif
Other DBs
NCBI-ProteinID: CBY61321
LinkDB All DBs
Position
2166777..2167679
Genome map
AA seq 300 aa AA seqDB search
MTLELHNVTKNFGTKVAVNDLSFRVEPGKILGLIGQNGAGKTTTFRLILHFLEATSGKIT
WDGKEVSKIDPNIIGYLPEERGLYPNVTIEEQLIFFAELKGYPKQKIKAEIDSWLERAEI
VGKKTDLIKTLSKGNQQKIQLLSTIIHQPKLVILDEPFSGLDPVNAEILKKFVFDLRASG
AAIIFSSHRMENVEELCDSLLMLKKGNVVLQGTTESVKSVFGRKRILIESSHSAAELATL
PGVLNVQTHRDGVLQLEIAHESDAEKIFDYVTKDGFIQTFSLQAPTLEEIFKWKAGELNE
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcttgaactacataatgttacgaagaactttggaacaaaggtcgctgtcaatgat
ttatcgtttcgggtagaaccaggaaaaatactcggattaattggtcaaaatggcgctggt
aaaacaactacttttcgccttattttgcattttttagaagctacttctggaaaaatcact
tgggacggcaaagaagtaagcaaaatcgatccaaatattatcggctatttacccgaagaa
cgtggtttatatccaaatgtcacaattgaagaacaattaatattttttgctgaattaaaa
ggatatccaaaacaaaaaataaaggcagaaattgatagctggctagaacgcgctgaaatt
gtcggtaaaaaaacagacttaatcaaaacactatccaaaggaaatcaacaaaaaatccag
cttttaagtacaattatccaccaaccaaaactagttatcttagatgaaccattcagcggt
ttagacccagtcaatgcagaaattttgaaaaagtttgtatttgacttacgcgcttctggg
gcagctattattttttccagtcatcggatggaaaatgtggaggagctttgcgactcgcta
ttaatgttaaaaaaaggaaatgtggtcctccaaggaacgactgaatctgtaaaatctgtt
tttggtcgtaaacgtattttgattgaatccagccacagtgcagcagaactcgctacttta
cctggtgtattaaatgtccaaacccaccgtgatggcgttctacagcttgaaattgcgcat
gaaagcgacgcagagaaaatttttgactatgtaacaaaagatggtttcatccaaacattc
agtctccaagctccaacactggaagaaattttcaaatggaaggctggtgagttgaatgag
taa

DBGET integrated database retrieval system