KEGG   Listeria monocytogenes SLCC7179 (serotype 3a): LMOSLCC7179_2263Help
Entry
LMOSLCC7179_2263  CDS       T02224                                 

Definition
(GenBank) polar amino acid ABC transporter, substrate-binding protein
  KO
K16957  L-cystine transport system substrate-binding protein
Organism
lmos  Listeria monocytogenes SLCC7179 (serotype 3a)
Pathway
lmos02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:lmos00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    LMOSLCC7179_2263
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lmos02000]
    LMOSLCC7179_2263
Transporters [BR:lmos02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   L-Cystine transporter
    LMOSLCC7179_2263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 NMT1 TcdB_toxin_midN DUF2969 DUF5061 LPAM_1
Motif
Other DBs
NCBI-ProteinID: CBY61469
LinkDB All DBs
Structure
PDB: 

Position
complement(2318366..2319175)
Genome map
AA seq 269 aa AA seqDB search
MKKKYGILALALTAALTLSACGGKEEPEAANQKVQTITVGTGTQFPNVCFLDENGKLTGY
DVELVKEIDKRLPGYKFKFKTMDFSNLLVSLGAGKVDIVAHQMEKSKEREKKFLFNDVAY
NNFPLQLTVLDSNNSINSTKDLAGKRVITSATSNGALVLKKINEEQGNNFEIAYEGQGSN
DTANQLKTGRADATISTPFAVDFQNKTSAIKEKVVGDVLSNAKVYFMLGKDETKLSKKVD
EALQSIIDDGTLKKLSEKWLGADYSKEQY
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaatatgggattttggcgcttgctcttacagctgcattaacattaagcgca
tgtggtggaaaagaggagccagaagcagcgaatcaaaaagtacaaacaatcacggttgga
acaggaacgcaatttccaaatgtctgctttttagatgaaaatgggaaattaactggttat
gatgtcgaactagtaaaagaaatcgacaaacgtttgcccggctataaatttaaatttaaa
acgatggatttttctaacttactcgttagccttggtgctggaaaagtagatattgtcgcg
catcaaatggaaaaaagtaaagaacgcgagaagaaatttttatttaatgatgtagcgtac
aataatttcccattacaattgacggtattagacagtaataacagcataaacagcacaaaa
gatttagctggaaaacgcgttatcacaagcgcaacatcgaatggggcactcgtgttgaaa
aaaatcaatgaagaacaaggcaataattttgaaattgcttatgaaggtcaagggtcaaat
gatacagcgaaccaactgaaaactggccgcgctgatgcaacgatttctacaccattcgcg
gtagatttccaaaataaaacaagcgctatcaaagaaaaagtagttggcgatgttctatct
aatgcgaaagtatacttcatgcttggaaaagatgaaacgaaactaagcaaaaaggtagat
gaggcgcttcaatctattattgatgatggaacccttaaaaaattaagtgaaaaatggctt
ggcgcagattattcaaaagaacaatattaa

DBGET integrated database retrieval system