KEGG   Listeria monocytogenes SLCC7179 (serotype 3a): LMOSLCC7179_2278Help
Entry
LMOSLCC7179_2278  CDS       T02224                                 

Gene name
gadG
Definition
(GenBank) glutamate decarboxylase beta
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lmos  Listeria monocytogenes SLCC7179 (serotype 3a)
Pathway
lmos00250  Alanine, aspartate and glutamate metabolism
lmos00410  beta-Alanine metabolism
lmos00430  Taurine and hypotaurine metabolism
lmos00650  Butanoate metabolism
lmos01100  Metabolic pathways
lmos01110  Biosynthesis of secondary metabolites
lmos01120  Microbial metabolism in diverse environments
lmos02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lmos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LMOSLCC7179_2278 (gadG)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LMOSLCC7179_2278 (gadG)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LMOSLCC7179_2278 (gadG)
   00430 Taurine and hypotaurine metabolism
    LMOSLCC7179_2278 (gadG)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    LMOSLCC7179_2278 (gadG)
Enzymes [BR:lmos01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     LMOSLCC7179_2278 (gadG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC DUF3826
Motif
Other DBs
NCBI-ProteinID: CBY61484
LinkDB All DBs
Position
2334884..2336278
Genome map
AA seq 464 aa AA seqDB search
MLYSKENKESYLEPVFGSSAEDRDIPKYTLGKEPLEPRIAYRLVKDELLDEGSARQNLAT
FCQTYMEDEATKLMSETLEKNAIDKSEYPRTAELENRCVNIIADLWHAPKDQKFMGTSTI
GSSEACMLGGMAMKFAWRKRAEKLGLDIYAKKPNLVISSGYQVCWEKFCVYWDIDMRVVP
MDKEHMQLNTDQVLDYVDEYTIGVVGILGITYTGRYDDIYALNEKLEEYNSKTDYKVYIH
VDAASGGFFTPFVEPDIIWDFRLKNVISINTSGHKYGLVYPGIGWVLWKDESYLPEELIF
KVSYLGGEMPTMQINFSRSASHIIGQYYNFLRYGFEGYRTIHQKTSDVAQYLAHAVEQTG
YFDIFNDGSHLPIVCYKLKNDANVKWTLYDLADRLQMRGWQVPAYPLPKSLENIIIQRYV
CRADLGFNMAEEFIQDFQASIQELNNAHILFHDTQQSGVHGFTH
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgttatatagtaaagaaaataaagaaagttatttagaaccagttttcggatcaagtgca
gaggatcgtgatattcctaaatacaccctcggaaaagaaccactcgaacctcggattgct
taccgtttagtgaaagacgaacttttagatgaaggttccgcccgccaaaacctagctact
ttttgccaaacatatatggaagacgaagcaaccaaattaatgtccgaaacactagaaaaa
aatgcgattgataaatccgaataccctagaacagccgaacttgaaaatcgttgcgtcaat
attatcgctgacttatggcatgcacctaaggaccaaaaatttatgggaacttccacaatc
ggctctagtgaagcgtgtatgcttggcggaatggcaatgaaatttgcttggagaaaacgt
gccgaaaaacttggcctagatatttatgcaaaaaaaccaaatctcgttatctcctctggc
taccaagtgtgttgggaaaaattctgtgtttactgggatatcgatatgcgcgttgttcca
atggataaagagcacatgcaactcaataccgatcaagtccttgattacgtcgatgaatat
acaatcggtgtggtcggcatcctcggtatcacttacacaggccgctatgatgacatctac
gcgctaaatgaaaaacttgaagaatacaatagcaaaaccgattataaagtctacattcac
gtcgatgcagctagtggaggtttcttcactccatttgtcgaacctgacattatctgggac
ttccgtttgaaaaacgttatctcaattaatacttccggtcacaaatacggcctcgtttat
ccaggtatcggttgggtcctttggaaagatgaaagctacctaccagaagaactcatcttt
aaagtcagctaccttggcggagaaatgccaaccatgcaaatcaatttctctcgcagtgcg
agccacatcatcggtcaatactacaatttcttacgctacggcttcgaaggctaccgcacc
attcaccaaaaaacaagcgatgtcgcacaataccttgctcacgcagtcgaacaaacaggc
tactttgacatttttaacgatggctcacacttaccaatcgtctgctataaattaaaaaac
gacgctaatgtaaaatggacattatacgatttagcggaccgcctccaaatgcgcggctgg
caagttcccgcatatccactaccaaaaagcttggaaaacattattattcaacgttacgtc
tgccgcgctgaccttggtttcaacatggcagaagaattcatccaagatttccaagcctct
attcaagaactaaacaacgcccacatccttttccacgatacccaacaatccggcgtccac
ggcttcacacattaa

DBGET integrated database retrieval system