KEGG   Listeria monocytogenes SLCC2540 (serotype 3b): LMOSLCC2540_1518Help
Entry
LMOSLCC2540_1518  CDS       T02242                                 

Gene name
sodA
Definition
(GenBank) iron/manganese superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
lmot  Listeria monocytogenes SLCC2540 (serotype 3b)
Brite
Enzymes [BR:lmot01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     LMOSLCC2540_1518 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CBY76159
LinkDB All DBs
Position
complement(1503592..1504200)
Genome map
AA seq 202 aa AA seqDB search
MTYELPKLPYTYDALEPNFDKETMEIHYTKHHNTYVTKLNEAVAGHPELASKSVEELVAN
LDSVPEDIRGAVRNHGGGHANHTLFWSILSPNGGGAPTGNLKAAIESEFGTFDEFKEKFN
AAAAARFGSGWAWLVVNDGKLEIVSTANQDSPLSDGKTPVLGLDVWEHAYYLKFQNRRPE
YIDTFWNVINWDEANKRFDAAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgacttacgaattacctaaattaccttatacttatgatgctttggagccgaattttgat
aaagaaactatggaaattcactatacaaagcaccacaatacttatgtgacaaaactaaat
gaagcggttgctggtcatcctgaacttgcaagcaaatctgtggaagaattagtagctaac
ttagatagcgttcctgaagatattcgcggcgctgtccgtaaccacggtggcggtcatgct
aaccatacattattctggtctattcttagcccaaatggtggtggcgctccaactggtaat
ttaaaagcagcaatcgaaagcgaattcggtacttttgacgaatttaaagaaaaattcaat
gcagctgctgcagcacgttttggttctggctgggcttggctagtagttaatgatggcaaa
ttagaaatcgtttctacagctaaccaagattctccactaagcgatggcaaaacacctgtt
cttggcttagatgtttgggaacatgcttactaccttaaattccaaaatcgtcgtcctgaa
tatatcgacacattttggaatgttattaactgggatgaagctaacaaacgttttgacgca
gctaaataa

DBGET integrated database retrieval system