KEGG   Listeria monocytogenes SLCC2540 (serotype 3b): LMOSLCC2540_2398Help
Entry
LMOSLCC2540_2398  CDS       T02242                                 

Gene name
gadG
Definition
(GenBank) glutamate decarboxylase beta
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lmot  Listeria monocytogenes SLCC2540 (serotype 3b)
Pathway
lmot00250  Alanine, aspartate and glutamate metabolism
lmot00410  beta-Alanine metabolism
lmot00430  Taurine and hypotaurine metabolism
lmot00650  Butanoate metabolism
lmot01100  Metabolic pathways
lmot01110  Biosynthesis of secondary metabolites
lmot01120  Microbial metabolism in diverse environments
lmot02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lmot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LMOSLCC2540_2398 (gadG)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LMOSLCC2540_2398 (gadG)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LMOSLCC2540_2398 (gadG)
   00430 Taurine and hypotaurine metabolism
    LMOSLCC2540_2398 (gadG)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    LMOSLCC2540_2398 (gadG)
Enzymes [BR:lmot01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     LMOSLCC2540_2398 (gadG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC DUF3826
Motif
Other DBs
NCBI-ProteinID: CBY77039
LinkDB All DBs
Position
2451593..2452987
Genome map
AA seq 464 aa AA seqDB search
MLYSKENKESYLEPVFGSSAEDRDIPKYTLGKEPLEPRIAYRLVKDELLDEGSARQNLAT
FCQTYMEDEATKLMSETLEKNAIDKSEYPRTAELENRCVNIIADLWHAPKNQKFMGTSTI
GSSEACMLGGMAMKFAWRKRAEKLGLDIYAQKPNLVISSGYQVCWEKFCVYWDIDMRVVP
MDKDHMQLNTDQVLDYVDEYTIGVVGILGITYTGRYDDIYALNEKLEEYNSKTDYKVYIH
VDAASGGFFTPFVEPDIIWDFRLKNVISINTSGHKYGLVYPGIGWVLWKDESYLPEELIF
KVSYLGGEMPTMQINFSRSASHIIGQYYNFLRYGFEGYRTIHQKTSDVAQYLAHAVEQTG
YFDIYNDGSHLPIVCYKLKDDANVKWTLYDLADRLQMRGWQVPAYPLPKNLENIIIQRYV
CRADLGFNMAEEFIQDFQASIQELNNAHILFHDTQQSGVHGFTH
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgttatatagtaaagaaaataaagaaagttatttagaaccagttttcggatcaagtgca
gaggatcgtgatattcctaaatataccctcggaaaagaaccactagaacctcggattgcc
tatcgtttagtgaaagacgaacttttagatgaaggttctgcccgtcaaaacttagctact
ttttgccaaacatatatggaagacgaagcaaccaaattaatgtccgaaacactagaaaaa
aatgcaatcgataaatctgagtacccaagaacagctgaactagaaaatcgttgcgtcaat
attatcgctgacttatggcatgcacctaagaaccaaaaattcatgggaacttccacaatc
ggctctagtgaagcgtgtatgctgggcggaatggcaatgaaatttgcttggagaaaacgt
gcggaaaaacttggcttagatatttatgcgcaaaaaccaaacctcgttatctcctctggc
taccaagtgtgctgggaaaaattctgtgtctactgggatatcgatatgcgcgttgttcca
atggataaagatcacatgcaactgaataccgaccaagtccttgattacgtcgacgaatat
acaatcggcgttgtcggcatcctcggcatcacatacacaggccgctacgatgacatctac
gcacttaacgaaaaattagaagaatacaatagcaaaacagattataaagtctacattcac
gttgacgcagctagtggtggcttcttcactccatttgtcgaacccgatattatctgggac
ttccgcttgaaaaacgttatctccattaatacttctggtcacaaatacggcctcgtttat
cctggtatcggttgggtcctttggaaagatgaaagctacctaccagaagaacttattttt
aaagtcagctaccttggcggagaaatgccaaccatgcaaatcaatttctcccgcagtgcg
agccacatcatcggtcaatactacaatttcttacgctacggcttcgaaggctaccgcacc
attcatcaaaaaacaagcgatgtagcacaataccttgcccatgcagtcgaacaaaccggc
tactttgacatttataacgacggctcccatttaccaatcgtctgctataaattaaaagac
gacgctaacgtaaaatggacattatatgatttagcggaccgcctccaaatgcgcggctgg
caagttcccgcatacccactaccaaaaaacttagaaaacatcatcatccaacgttacgtc
tgccgcgctgacctcggtttcaacatggcagaagaattcatccaagatttccaagcctct
attcaagaactaaacaacgctcacatcctcttccatgatacccaacaatccggcgtccac
ggcttcacacattaa

DBGET integrated database retrieval system