KEGG   Listeria monocytogenes SLCC2540 (serotype 3b): LMOSLCC2540_2704Help
Entry
LMOSLCC2540_2704  CDS       T02242                                 

Definition
(GenBank) polyol dehydrogenase, zinc-dependent
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
lmot  Listeria monocytogenes SLCC2540 (serotype 3b)
Pathway
lmot00040  Pentose and glucuronate interconversions
lmot00051  Fructose and mannose metabolism
lmot01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LMOSLCC2540_2704
   00051 Fructose and mannose metabolism
    LMOSLCC2540_2704
Enzymes [BR:lmot01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     LMOSLCC2540_2704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 2-Hacid_dh_C FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: CBY77345
LinkDB All DBs
Position
complement(2759051..2760082)
Genome map
AA seq 343 aa AA seqDB search
MKAVVKTNPGYDQMELRDVEEPQVYGDKVKIKVAFTGICGSDIHTFKGEYKNPTTPVTLG
HEFSGVVVEVGPDVTSIKVGDRVTSETTFETCGECIYCKERDYNLCSNRRGIGTQANGSF
AEFVLSREESCHVLDERISLEAAALTEPLACCVHSALEKTTIRPDDTVLVFGPGPIGLLL
AQVVKAQGATVIMAGITKDSDRLRLAKELGMDRIVDTLKEDLAEVVLGMTDGYGAERVFD
CSGAVPAVNQGLPLTKKKGDFVQVGLFAEKKNAIDEESIIQREIAYIGSRSQKPSSWILA
LDLLANGKINTDKMITKVYGLDDWREAFEAVMAGNEIKVLVKS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagcagtagtaaaaacaaaccccggatatgatcaaatggagctaagagatgtagaa
gaaccacaggtctatggcgacaaagtaaaaatcaaagtagcattcactggcatttgcgga
tcagacatccatacgtttaaaggtgaatacaaaaatccaacaactcccgtcacactggga
catgaattttctggtgtcgttgtagaagttgggccagatgtaacaagtatcaaagtggga
gaccgtgtcacaagtgaaacaacttttgaaacttgtggagaatgtatttattgtaaggaa
cgtgattacaatttatgtagcaatcgtcgcggcattggtacgcaagcaaatggtagtttt
gcagaatttgttttatctcgcgaagaaagttgtcacgtgcttgatgaacgtatttcgctc
gaagcagcagcactaacagaaccgcttgcatgttgtgtgcattcggcgcttgaaaaaaca
acgattcgtccagatgacacagtacttgttttcggaccaggtccaattggtttgttacta
gctcaagttgtgaaagcgcaaggggcaacggtgattatggcaggaattaccaaagatagt
gaccgcttacgtctagcaaaagagcttggaatggaccggattgtcgatactttaaaagaa
gacttggctgaagttgtgcttggcatgacagatggttacggagcggaacgcgtatttgat
tgttctggcgcagtacccgctgtaaatcaaggattacctctaacgaagaaaaaaggcgat
tttgttcaagtaggactttttgccgaaaagaaaaatgcgattgatgaagaatccattatc
caacgtgaaattgcttatatcggcagccgttcgcaaaaaccatcttcttggattttagcg
ctcgacttactggcaaatggcaaaatcaatacggataaaatgattactaaagtatacggt
ttggatgactggcgcgaggctttcgaggcagttatggcaggaaatgaaattaaagtatta
gtgaaatcttaa

DBGET integrated database retrieval system