KEGG   Listeria monocytogenes WSLC1001 (serotype 1/2a): AX10_11365Help
Entry
AX10_11365        CDS       T03114                                 

Definition
(GenBank) ATP phosphoribosyltransferase
  KO
K02502  ATP phosphoribosyltransferase regulatory subunit
Organism
lmow  Listeria monocytogenes WSLC1001 (serotype 1/2a)
Pathway
lmow00340  Histidine metabolism
lmow01100  Metabolic pathways
lmow01110  Biosynthesis of secondary metabolites
lmow01230  Biosynthesis of amino acids
Module
lmow_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:lmow00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    AX10_11365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_His tRNA-synt_2
Motif
Other DBs
NCBI-ProteinID: AHJ05068
LinkDB All DBs
Position
complement(2261842..2263023)
Genome map
AA seq 393 aa AA seqDB search
MNLNKNLPTGTRDKLFREARAAYKIEQQVNHYFEKRGFKRIETPVIEFEDVFSSEHQADA
KLYRFFDEKGRLTVLRPDMTLPIGRVVSTTGVMLPLKLSYSGKIFRANEDFGGEQNEQTQ
AGIEIIGYPSIKAEIECILIGIGVLNALEIPNFQIELGHAAIYRRVTNLLNLSETAEIDF
RLLIQNKSLTGIKRFVADNPSTLDDFILALPRLFGPATAILKQAKNLTTDKGILTALREM
ETIVEAVSYTADISVDLGLVQDFHYYTGIIFRGYADLAADNFLSGGRYDHLLEQFTSASS
PAVGLALNLDSLTTLQNRAGVIKKQVSTSLLIHYDLDAIQQAEKLMQETPNSELSFFETP
TNAISFAKKWHIPAVIHVSRQGIQTIFQREADL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaacttaaataagaacttaccaactggaacacgtgataaactttttcgtgaagcacga
gctgcatacaaaattgagcaacaagtgaatcattattttgaaaaacgcggatttaagcgg
attgaaacgcctgttatcgagtttgaagatgtcttttcctctgaacatcaagccgatgcg
aagttgtatcgtttctttgacgaaaaaggtcgcttgacggttcttaggccggatatgaca
cttccgattggtcgagttgttagtaccactggtgtgatgctccctctaaaactttcttat
agcggaaaaatttttcgcgcaaatgaagattttggtggcgaacaaaacgaacaaacgcaa
gcaggtattgaaatcattggctacccttcgattaaagcagagattgaatgcattttgatt
gggattggagttttaaatgctctagaaattccgaattttcaaattgaactcggacatgca
gcaatttatagacgcgtaaccaaccttttaaatctctccgaaacagctgaaattgatttt
cgcttgctgattcagaataaaagtttaactggtattaagcgatttgtagccgataatccg
agtacgcttgacgatttcattttagcactaccacgattatttggaccagcgacagcgatt
ttaaaacaagccaaaaatttaacaacggacaaaggcattttaacggcactgcgtgaaatg
gaaaccattgtggaagctgtttcttacacagcagatattagtgtcgatttaggactcgtg
caagattttcattattatacaggtataatttttagaggatatgctgaccttgctgctgat
aattttttaagcggcggccgttacgatcacctcctagaacaattcaccagcgcttcctcc
ccagcagttggtttggctcttaatcttgactccctcacaaccctacaaaaccgcgctggc
gtcatcaaaaagcaagtttctacaagccttttaattcactacgacctagacgcaatccaa
caagcagaaaaactcatgcaagaaacaccaaatagcgaattaagtttttttgaaactccg
acaaacgctatctctttcgcaaaaaaatggcatattccagccgttatccatgtctcgagg
caaggcatccaaactatttttcaaagggaggcagacttatga

DBGET integrated database retrieval system