KEGG   Listeria monocytogenes WSLC1001 (serotype 1/2a): AX10_11630Help
Entry
AX10_11630        CDS       T03114                                 

Definition
(GenBank) hypothetical protein
  KO
K07090  uncharacterized protein
Organism
lmow  Listeria monocytogenes WSLC1001 (serotype 1/2a)
Brite
KEGG Orthology (KO) [BR:lmow00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    AX10_11630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE BacA DDDD
Motif
Other DBs
NCBI-ProteinID: AHJ05121
LinkDB All DBs
Position
2316866..2317606
Genome map
AA seq 246 aa AA seqDB search
MDIITYFLIALSTSVVGSFLGIGGGVILLPILLLMGVSQGTAAFSSALTVFTMAIFTCSI
YYKRKQGNVGLALKIAVTSIPTTFIGAMVNQMLPEAVYRFLYGALIVVLLGIMIWKKKRN
NEKPHFLSEYRIIPYVFGVIIGFLAGLFGIGGGPIVIPILLLIFMLNQKTASATSSYVTL
LTSLASIGSYAIIGGSDFSIGIYMIPGAIIGALIGTRLNKLLDEKWIAILFNVLLIALFA
LNLIKI
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggatataattacgtactttctaattgcactaagtacaagtgttgtaggaagtttttta
ggaataggtggaggagttatccttttgccaattctactcttgatgggtgtttcacaagga
acagcagcatttagttcggctctaactgtgttcacgatggcgatttttacgtgtagtatt
tattataagagaaagcaagggaatgtaggcttggcactgaaaattgccgtaactagtatt
ccaacaacttttattggcgcaatggtgaatcaaatgttgcctgaagcagtctatcgtttt
ctgtacggagcattaattgttgttttactagggataatgatttggaaaaagaaacggaac
aatgaaaaaccacattttttaagtgaatatcgcataataccatatgtattcggtgtaatt
attggatttttagcgggcttatttggcatcggtggcgggccaattgtcataccaattttg
ctattaattttcatgttgaaccaaaaaacagcatccgcgacatcaagttatgtgacatta
ctaacatcacttgcaagtatcggctcctatgcaatcattggtggaagtgatttttcgatt
gggatttacatgataccaggggcaatcatcggagcgctcattggcacaagattaaataaa
ctcctagatgaaaaatggattgcaatattatttaatgttttacttattgccctttttgct
ttaaatttaattaagatttaa

DBGET integrated database retrieval system