KEGG   Listeria monocytogenes WSLC1042 (serotype 4b): AX24_05025Help
Entry
AX24_05025        CDS       T03151                                 

Definition
(GenBank) ABC transporter
  KO
K02003  putative ABC transport system ATP-binding protein
Organism
lmox  Listeria monocytogenes WSLC1042 (serotype 4b)
Brite
KEGG Orthology (KO) [BR:lmox00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lmox02000]
    AX24_05025
Transporters [BR:lmox02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Putative ABC transporter
    AX24_05025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_22 SbcCD_C AAA_29 Imm51 DNTTIP1_dimer AAA_30
Motif
Other DBs
NCBI-ProteinID: AHJ35572
LinkDB All DBs
Position
complement(924891..925586)
Genome map
AA seq 231 aa AA seqDB search
MTKVLTFENISYWYKTKEESILSDINYDFEAGVFYTVVGSSGSGKTTFLSLAGGLDTQKE
GDIFYKGSSLKSIGLQQFRNKYVSIVFQSYNLLTYMTALQNVTTAMEITHVNQPDKKAFA
LSMLEKVGITEDMARQKVLTLSGGQQQRVSIARALCCETELIVADEPTGNLDERTSKEVV
TLFQDLAHKEGKCVIMVTHDPEIAKVSDVKLTLKNGSFVEKKQSTNSLINS
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagtattaacgtttgaaaatatttcttattggtataaaacgaaagaagaatcc
attttaagtgacatcaattatgattttgaagcgggtgttttttatacagtagtcggcagt
tctggctcaggaaaaacaactttcttatctcttgcaggaggtcttgatacgcaaaaagaa
ggagatattttctataaaggtagctcactcaaaagtattggcttacaacagtttagaaat
aaatatgtatcgattgtgttccaaagttataatctgttgacctatatgaccgcactacaa
aatgtcacaactgcaatggaaattacccatgtcaatcaaccagataaaaaagcctttgct
ctaagtatgctggaaaaagtaggtatcacagaagacatggcacgccaaaaagtattgacg
ttaagcggtggccaacaacaacgggtttcgatagcgcgggctctctgctgtgaaacggaa
ttaattgtagcggatgaaccaaccggaaatttggatgaacgtactagtaaagaagtagtt
actttattccaagatttagcgcataaagaaggtaaatgcgttattatggtgacgcatgat
cccgagattgcaaaagtgtccgatgtgaaactaacgcttaaaaacggaagctttgttgaa
aagaaacaatcaacgaatagtctaataaacagttga

DBGET integrated database retrieval system