KEGG   Listeria monocytogenes WSLC1042 (serotype 4b): AX24_06865Help
Entry
AX24_06865        CDS       T03151                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
lmox  Listeria monocytogenes WSLC1042 (serotype 4b)
Brite
KEGG Orthology (KO) [BR:lmox00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lmox01001]
    AX24_06865
Enzymes [BR:lmox01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AX24_06865
Protein kinases [BR:lmox01001]
 Serine/threonine kinases: Other
  Bacterial family
   AX24_06865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr Haspin_kinase APH Kinase-like Kdo RIO1 Seadorna_VP7 YukC LPD29
Motif
Other DBs
NCBI-ProteinID: AHJ35889
LinkDB All DBs
Position
complement(1282633..1284600)
Genome map
AA seq 655 aa AA seqDB search
MMIGKRLSDRYKILHAIGGGGMANVYLAHDIILDRDVAVKILRIDLADESNLIRRFQREA
QSATSLVHPNIVSVYDVGEENDLHYIVMEHVDGMDLKQYIHENHPISYDKAVDIMLQIVS
AVAIAHQHHIIHRDLKPQNILIDHDGVVKITDFGIAMALSETSITQTNSLLGSVHYLSPE
QARGGMATQKSDIYSLGIVLYELLTGKVPFDGESAVSIAIKHLQADIPSARAQNLEIPQS
LENIIIKATAKDPFLRYQNAEEMEKDLQTCLNQDRLNEPKYIFPTDDGDTKAIPIIATKD
TMQNLDKTIVPEGKVAAAEVAPEENKGKKKKKMSKKKKIALIVSSVIIIFIIGILLLWLL
GKSPDEVAVPDVSGKTEDQAVALLQKEGFVIGKTAEKNSDEVAEGKVINTDPEAGEMKEK
GTKINLFVSIGSKKITMDDYTGRSYTDTKALLEEQGFNNISSEEAYSSEVEKGLIISQTP
TQGTDVVAKSTDVKFVVSKGAEPISLKDLRGYTKTAVEDYASPLGLKVSSKEENSNTVEK
GQVISQSPSAGTAMNPGDTIEIVISAGPKEKQVKEVTKTFNIPYTPSDEENPQPQKIQIY
IQDKDHSMTSAYREMSITQNTSVEITFQIEEGSSAGYKIISDDKVIDEGTVPYPN
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgatgattggtaagcgattaagtgatcgatataaaattttacatgcaataggcggcggc
ggaatggccaatgtgtatttggcgcatgatattattcttgatagagatgttgcagtaaaa
attttacgaatcgatttagctgatgaaagcaaccttattcgtcggtttcaacgggaagct
caatcagcaacgagccttgttcaccctaatattgttagtgtttacgatgttggtgaagaa
aatgatttacattatattgtaatggaacatgtggatggaatggatttaaaacagtatatt
cacgaaaatcacccaatcagttacgataaagctgtagatattatgcttcaaatcgtttct
gcggtggcaattgcccatcaacatcacattattcatcgtgatttaaaaccacagaatatt
ttaatcgatcatgatggcgtagtgaaaattactgattttgggattgcgatggcactttca
gaaacatccatcacacaaacaaattctttgttaggttcggtgcattacttatcaccagaa
caagcacgtggtggaatggctactcaaaaatcagacatctattcactaggaatcgtgcta
tatgaactattaactggaaaagttcctttcgacggtgagtctgcagtttctattgctatt
aagcatttgcaagcggatattccatcagcaagagcgcaaaatctagaaattcctcaaagc
ttagaaaatattatcattaaagcaacggcaaaagatccatttttacgttatcaaaacgcg
gaagaaatggaaaaagacttgcaaacttgtttaaatcaagaccgtttaaatgagcctaaa
tatattttcccaacagatgatggtgatacaaaagcaattccaatcatcgcaacgaaagac
acgatgcaaaaccttgacaaaacgattgtcccagaaggaaaagtagcagcggctgaagtt
gctcccgaagagaacaaaggtaagaaaaagaaaaaaatgagtaagaaaaagaaaattgct
ctcattgtttcttctgtcattatcatttttatcatcggtattttactactgtggctttta
ggcaagagccctgatgaagtcgctgtgccggatgtttctggtaaaacggaagaccaagca
gtagcgctactccaaaaagaaggctttgtcataggtaaaacggcagaaaaaaatagtgat
gaagtagcggaagggaaagtaattaataccgacccagaagctggagaaatgaaagaaaaa
ggaacaaaaatcaatttattcgtaagcattggttctaaaaaaataactatggacgactat
acaggaagaagctacacagatacaaaagcgttacttgaagaacaagggtttaataatatt
tcttcggaggaagcatatagttctgaagttgaaaaaggcttaattataagccaaacaccg
actcaaggaacggacgtagtcgctaaatctaccgatgtgaaatttgtcgtaagtaaaggt
gcagaaccaatttcgcttaaagatttacgcggctataccaaaacagctgtagaagattat
gcctcaccacttggactcaaagtttcaagtaaggaagaaaattcaaatacagttgaaaaa
ggacaagttatttcgcagtccccatcagctggaactgcaatgaatcctggtgatacaatc
gagattgtcatttctgcaggaccaaaagaaaaacaagtcaaagaagtaactaaaacattt
aacatcccatatacaccaagtgatgaagaaaacccacaaccacagaaaattcaaatctac
attcaagataaagaccatagcatgactagcgcttaccgagaaatgagcattacacaaaat
acctcggtagaaataactttccaaattgaagaaggttctagcgcaggctacaaaattatc
agtgatgataaagtaatcgatgaaggtacagtcccttatccaaattaa

DBGET integrated database retrieval system