KEGG   Listeria monocytogenes WSLC1042: AX24_09615Help
Entry
AX24_09615        CDS       T03151                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lmox  Listeria monocytogenes WSLC1042
Pathway
lmox00250  Alanine, aspartate and glutamate metabolism
lmox00410  beta-Alanine metabolism
lmox00430  Taurine and hypotaurine metabolism
lmox00650  Butanoate metabolism
lmox01100  Metabolic pathways
lmox01110  Biosynthesis of secondary metabolites
lmox01120  Microbial metabolism in diverse environments
lmox02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lmox00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    AX24_09615
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AX24_09615
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AX24_09615
   00430 Taurine and hypotaurine metabolism
    AX24_09615
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    AX24_09615
Enzymes [BR:lmox01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AX24_09615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC DUF3826
Motif
Other DBs
NCBI-ProteinID: AHJ36403
LinkDB All DBs
Position
1832071..1833465
Genome map
AA seq 464 aa AA seqDB search
MLYSKENKESYLEPVFGSSAEDRDIPKYTLGKEPLEPRIAYRLVKDELLDEGSARQNLAT
FCQTYMEDEATKLMSETLEKNAIDKSEYPRTAELENRCVNIIADLWHAPKNQKFMGTSTI
GSSEACMLGGMAMKFAWRKRAEKLGLDIYAQKPNLVISSGYQVCWEKFCVYWDIDMRVVP
MDKDHMQLNTDQVLDYVDEYTIGVVGILGITYTGRYDDIYALNEKLEEYNSKTDYKVYIH
VDAASGGFFTPFVEPDIIWDFRLKNVISINTSGHKYGLVYPGIGWVLWKDESYLPEELIF
KVSYLGGEMPTMQINFSRSASHIIGQYYNFLRYGFEGYRTIHQKTSDVAQYLAHAVEQTG
YFDIYNDGSHLPIVCYKLKDDANVKWTLYDLADRLQMRGWQVPAYPLPKNLENIIIQRYV
CRADLGFNMAEEFIQDFQASIQELNNAHILFHDTQQSGVHGFTH
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgttatatagtaaagaaaataaagaaagttatttagaaccagttttcggatcaagtgca
gaggatcgtgatattcctaaatataccctcggaaaagaaccactagaacctcggattgcc
tatcgtttagtgaaagacgaacttttagatgaaggttctgcccgtcaaaacttagctact
ttttgccaaacatatatggaagacgaagcaaccaaattaatgtccgaaacactagaaaaa
aatgcaatcgataaatctgagtacccaagaacagctgaactagaaaatcgttgcgtcaat
attatcgctgacttatggcatgcacctaagaaccaaaaattcatgggaacttccacaatc
ggctctagtgaagcgtgtatgctgggcggaatggcaatgaaatttgcttggagaaaacgt
gcggaaaaacttggcttagatatttatgcgcaaaaaccaaacctcgttatctcctctggc
taccaagtgtgctgggaaaaattctgtgtctactgggatatcgatatgcgcgttgttcca
atggataaagatcacatgcaactgaataccgaccaagtccttgattacgtcgacgaatat
acaatcggcgttgtcggcatcctcggcatcacttacacaggccgctacgatgacatctac
gcacttaacgaaaaattagaagaatacaatagcaaaacagattataaagtctacattcac
gtcgatgcagcaagtggcggattcttcacaccatttgtcgaacccgatattatctgggac
ttccgcttgaaaaacgttatctccattaatacttctggtcacaaatacggcctcgtttat
cctggtatcggttgggtcctttggaaagatgaaagctacctaccagaagaacttattttt
aaagtcagctaccttggcggagaaatgccaaccatgcaaatcaatttctcccgcagtgcg
agccacatcatcggtcaatactacaatttcttacgctacggcttcgaaggctaccgcacc
attcatcaaaaaacaagcgatgtagcacaataccttgcccatgcagtcgaacaaaccggc
tactttgacatttataacgacggctcccatttaccaatcgtctgctataaattaaaagac
gacgctaacgtaaaatggacattatatgatttagcggaccgcctccaaatgcgcggctgg
caagttcccgcatacccactaccaaaaaacttagaaaacatcatcatccaacgttacgtc
tgccgcgctgacctcggtttcaacatggcagaagaattcatccaagatttccaagcctct
attcaagaactaaacaacgctcacatcctcttccatgatacccaacaatccggcgtccac
ggcttcacacattaa

DBGET integrated database retrieval system