KEGG   Listeria monocytogenes WSLC1042 (serotype 4b): AX24_14740Help
Entry
AX24_14740        CDS       T03151                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
lmox  Listeria monocytogenes WSLC1042 (serotype 4b)
Pathway
lmox00330  Arginine and proline metabolism
lmox01100  Metabolic pathways
lmox01110  Biosynthesis of secondary metabolites
lmox01130  Biosynthesis of antibiotics
lmox01230  Biosynthesis of amino acids
Module
lmox_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lmox00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    AX24_14740
Enzymes [BR:lmox01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     AX24_14740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_binding_2 Shikimate_DH NAD_Gly3P_dh_N ApbA PDH IlvN Sacchrp_dh_NADP DapB_N Semialdhyde_dh 2-Hacid_dh_C 3HCDH_N GFO_IDH_MocA NAD_binding_3 Rossmann-like
Motif
Other DBs
NCBI-ProteinID: AHJ37298
LinkDB All DBs
Position
complement(2778488..2779288)
Genome map
AA seq 266 aa AA seqDB search
MKKIGFIGAGNMGTAMIRGLAQANLDNSEAIIVGGRNLEKLKPLEAAFTGLQITTDTEKL
VEQADIIILAVKPYTIPEILTSVKEQLTPDKIIISVAAGVTIQDLEELTSAKTKIVRVMP
NTPALVGEAMSSISPNINVSSEEINEVTAIFTSFGEAEVVSENLMDAVIGVSGSSPAYVY
MFIEALADGAVLSGMPRDKAYKFAAQAVLGAAKTVLETGEHPGKLKDMVTSPGGTTIEAV
KSLENDGFRSAVINAVQAAANKNSSM
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatcggctttattggcgcaggtaatatgggaactgcgatgattcggggctta
gcacaagcgaatttagataacagcgaagcaatcattgttggtggtcgaaatctcgaaaaa
ttaaaaccactggaagcggcatttactggcctgcaaataacaaccgataccgaaaaactc
gtagaacaagcagatattattattttagcggtgaaaccttacactatcccagaaatttta
acgtcggtaaaagagcagctaacacctgataaaattattatttctgtagcagctggcgta
actatccaagatttagaagaactcacttccgcaaaaacaaaaattgttcgtgtgatgcca
aatacaccagcgcttgtcggtgaagcaatgtcatctatttcgcctaacataaacgtatca
tctgaagaaattaatgaagttacagctatttttactagttttggagaagcggaagttgtt
tccgagaatttgatggatgcagttattggcgtcagcggttcttcaccagcttatgtttat
atgttcatagaagctttagcagacggcgccgtcctaagtggcatgcctcgcgataaagca
tataaattcgccgcacaagctgtgctaggtgccgcaaaaacggttctagaaaccggcgaa
catccaggtaaacttaaagatatggttacttctcccggcggaactacaattgaagcagtg
aaatcactagaaaatgatggtttccgttccgctgttatcaatgcagttcaagctgctgca
aacaaaaatagttcgatgtaa

DBGET integrated database retrieval system