KEGG   Listeria monocytogenes SLCC2479 (serotype 3c): LMOSLCC2479_2393Help
Entry
LMOSLCC2479_2393  CDS       T02241                                 

Definition
(GenBank) similar to competence transcription factor ComK, C-terminal part
  KO
K02250  competence protein ComK
Organism
lmoy  Listeria monocytogenes SLCC2479 (serotype 3c)
Pathway
lmoy02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lmoy00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    LMOSLCC2479_2393
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lmoy03000]
    LMOSLCC2479_2393
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lmoy02044]
    LMOSLCC2479_2393
Transcription factors [BR:lmoy03000]
 Prokaryotic type
  Other transcription factors
   Others
    LMOSLCC2479_2393
Secretion system [BR:lmoy02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) related proteins
   LMOSLCC2479_2393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ComK
Motif
Other DBs
NCBI-ProteinID: CBY58664
LinkDB All DBs
Position
2419496..2419972
Genome map
AA seq 158 aa AA seqDB search
MALVACLFRLFSPSFSLVGRKEGTKHLIGVTHKPPIIIDPVTSTYVFPTVAPSSTECIWI
FPQHIKDYHAIGFNHTLITFSNMETFEIDMSLASFNNQIARTSMLHMKFSQKMRIMESNF
PSMNRFFPPTTLAAEPRRYYSTMLPNNEEPNDPQDPEQ
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggctctagtggcttgtttatttagattgtttagtccctcgttttctctcgttggacgc
aaagagggaactaaacacttaattggtgttacccataagccacccattatcattgaccca
gtcacttctacttatgtatttccaactgtagcaccaagttcaacagaatgcatttggatt
ttcccacaacatattaaagattatcatgcaattggatttaaccacactttaataacattt
tctaatatggaaacctttgagattgatatgtctttagcatcttttaataatcagattgcc
agaacctccatgttacatatgaaattttctcaaaaaatgcgtattatggagagtaatttc
ccttcaatgaataggtttttcccaccaaccactcttgctgctgaacctagacgttattac
agcaccatgcttccaaataacgaagaacctaatgatcctcaagatcccgagcaataa

DBGET integrated database retrieval system