KEGG   Listeria monocytogenes SLCC2479: LMOSLCC2479_2424Help
Entry
LMOSLCC2479_2424  CDS       T02241                                 

Gene name
gadG
Definition
(GenBank) glutamate decarboxylase beta
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lmoy  Listeria monocytogenes SLCC2479 (serotype 3c)
Pathway
lmoy00250  Alanine, aspartate and glutamate metabolism
lmoy00410  beta-Alanine metabolism
lmoy00430  Taurine and hypotaurine metabolism
lmoy00650  Butanoate metabolism
lmoy01100  Metabolic pathways
lmoy01110  Biosynthesis of secondary metabolites
lmoy01120  Microbial metabolism in diverse environments
lmoy02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lmoy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LMOSLCC2479_2424 (gadG)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LMOSLCC2479_2424 (gadG)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LMOSLCC2479_2424 (gadG)
   00430 Taurine and hypotaurine metabolism
    LMOSLCC2479_2424 (gadG)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    LMOSLCC2479_2424 (gadG)
Enzymes [BR:lmoy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     LMOSLCC2479_2424 (gadG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC DUF3826
Motif
Other DBs
NCBI-ProteinID: CBY58695
LinkDB All DBs
Position
2450363..2451757
Genome map
AA seq 464 aa AA seqDB search
MLYSKENKESYLEPVFGSSAEDRDIPKYTLGKEPLEPRIAYRLVKDELLDEGSARQNLAT
FCQTYMEDEATKLMSETLEKNAIDKSEYPRTAELENRCVNIIADLWHAPKDQKFMGTSTI
GSSEACMLGGMAMKFAWRKRAEKLGLDIYAKKPNLVISSGYQVCWEKFCVYWDIDMRVVP
MDKEHMQLNTDQVLDYVDEYTIGVVGILGITYTGRYDDIYALNEKLEEYNSKTDYKVYIH
VDAASGGFFTPFVEPDIIWDFRLKNVISINTSGHKYGLVYPGIGWVLWKDESYLPEELIF
KVSYLGGEMPTMQINFSRSASHIIGQYYNFLRYGFEGYRTIHQKTSDVAQYLAHAVEQTG
YFDIFNDGSHLPIVCYKLKDDANVNWTLYDLADRLQMRGWQVPAYPLPKSLENIIIQRYV
CRADLGFNMAEEFIQDFQASIQELNNAHILFHDTQQSGVHGFTH
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgttatatagtaaagaaaataaagaaagttatttagaaccagttttcggatcaagtgca
gaggatcgtgatattcctaaatacaccctcggaaaagaaccactcgaacctcggattgct
taccgtttagtgaaagacgaacttttagatgaaggttccgcccgccaaaacctagctact
ttttgccaaacatatatggaagacgaagcaaccaaattaatgtccgaaacactagaaaaa
aatgcaatcgataaatctgaatacccaagaacagctgaacttgaaaatcgttgcgtcaat
attatcgctgacttatggcatgcacctaaggaccaaaaatttatgggaacttccacaatc
ggctctagtgaagcgtgtatgcttggcggaatggcaatgaaatttgcttggagaaaacgt
gccgaaaaacttggcctagatatttatgcaaaaaaaccaaatctcgttatctcctctggc
taccaagtatgttgggaaaaattctgtgtttactgggatatcgatatgcgcgttgttcca
atggataaagagcacatgcaactcaataccgatcaagtccttgattacgtcgatgaatat
acaatcggtgtggtcggcatcctcggtatcacttacacaggccgctatgatgacatctac
gcgctaaatgaaaaacttgaagaatacaatagcaaaaccgattataaagtctacattcac
gtcgatgcagctagtggaggtttcttcactccatttgtcgaacctgacattatctgggac
ttccgcttgaaaaacgttatctcgattaacacttccggtcataaatatggcctcgtttac
ccaggcatcggttgggtcctttggaaagatgaaagctatctaccagaagaactcatcttt
aaagtcagctaccttggcggagaaatgccaaccatgcaaatcaatttctcccgcagtgcg
agccacatcatcggtcaatactacaatttcttacgctacggcttcgaaggctaccgcacc
attcaccaaaaaacaagcgatgtagcacaataccttgcccatgcagtcgaacaaactggc
tactttgacatttttaacgatggctcccacttaccaatcgtctgctataaattaaaagac
gacgccaatgtaaattggacattatacgatttagcggaccgcctccaaatgcgcggctgg
caagttcccgcatatccactaccaaaaagcttggaaaacattattattcaacgttacgtc
tgccgcgctgaccttggtttcaacatggcagaagaattcatccaagatttccaagcctct
attcaagaactaaacaacgcccacatccttttccacgatacccaacaatccggcgtccac
ggcttcacacattaa

DBGET integrated database retrieval system