KEGG   Listeria monocytogenes J1-220 (serotype 4b): LM1816_02332Help
Entry
LM1816_02332      CDS       T02801                                 

Definition
(GenBank) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
lmoz  Listeria monocytogenes J1-220 (serotype 4b)
Pathway
lmoz00040  Pentose and glucuronate interconversions
lmoz00051  Fructose and mannose metabolism
lmoz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmoz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LM1816_02332
   00051 Fructose and mannose metabolism
    LM1816_02332
Enzymes [BR:lmoz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     LM1816_02332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 2-Hacid_dh_C FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: EGF39152
LinkDB All DBs
Position
complement(2541788..2542819)
Genome map
AA seq 343 aa AA seqDB search
MKAVVKTNPGYDQMELRDVEEPQVYGDKVKIKVAFTGICGSDIHTFKGEYKNPTTPVTLG
HEFSGVVVEVGPDVTSIKVGDRVTSETTFETCGECIYCKERDYNLCSNRRGIGTQANGSF
AEFVLSREESCHVLDERISLEAAALTEPLACCVHSALEKTTIRPDDTVLVFGPGPIGLLL
AQVVKAQGATVIMAGITKDSDRLRLAKELGMDRIVDTLKEDLAEVVLGMTDGYGAERVFD
CSGAVPAVNQGLPLTKKKGDFVQVGLFAEKKNAIDEESIIQREIAYIGSRSQKPSSWILA
LDLLANGKINTDKMITKVYGLDDWREAFEAVMAGNEIKVLVKS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagcagtagtaaaaacaaaccccggatatgatcaaatggagctaagagatgtagaa
gaaccacaagtctatggcgacaaagtaaaaatcaaagtagcattcactggtatttgcgga
tcagacatccatacgtttaaaggtgaatacaaaaatccaacaactcccgtcacactggga
catgaattttctggtgtcgttgtagaagttgggccagatgtaacaagtatcaaagtggga
gaccgtgtcacaagtgaaacaacttttgaaacttgtggagaatgtatttattgtaaggaa
cgtgattacaatttatgtagcaatcgtcgcggcattggtacgcaagcaaatggtagtttt
gcagaatttgttttatctcgcgaagaaagttgtcacgtgcttgatgaacgtatttcgctc
gaagcagcagcactaacagaaccgcttgcatgttgtgtgcattcggcgcttgaaaaaaca
acgattcgtccagatgacacagtacttgttttcggaccaggtccaattggtttgttacta
gctcaagttgtgaaagcgcaaggggcaacggtgattatggcaggaattaccaaagatagt
gaccgcttacgtctagcaaaagagcttggaatggaccggattgtcgatactttaaaagaa
gacttggctgaagttgtgcttggcatgacagatggttacggagcggaacgcgtatttgat
tgttctggcgcagtacccgctgtaaatcaaggattacctctaacgaagaaaaaaggcgat
tttgttcaagtaggactttttgccgaaaagaaaaatgcgattgatgaagaatccattatc
caacgtgaaattgcttatatcggcagccgttcgcaaaaaccatcttcttggattttagcg
ctcgacttactagcaaatggcaaaatcaatacggataaaatgattactaaagtatacggt
ttggatgactggcgcgaggctttcgaggcagttatggcaggaaatgaaattaaagtatta
gtgaaatcttaa

DBGET integrated database retrieval system