KEGG   Listeria monocytogenes J1-220 (serotype 4b): LM1816_15122Help
Entry
LM1816_15122      CDS       T02801                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase/oxidase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
lmoz  Listeria monocytogenes J1-220 (serotype 4b)
Pathway
lmoz00564  Glycerophospholipid metabolism
lmoz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmoz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    LM1816_15122
Enzymes [BR:lmoz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     LM1816_15122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 NAD_binding_8 Pyr_redox_2 FAD_oxidored FAD_binding_3 Pyr_redox 3HCDH_N Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: EGF39580
LinkDB All DBs
Position
1108694..1110370
Genome map
AA seq 558 aa AA seqDB search
MVQLFSAFDRETIERNLQEEKFDLVIVGGGITGAGIALDATSRGMSVALVEMGDFASGTS
SRSTKLVHGGLRYLQQFEIKEVADLGKERAIVYENGPHVTTPEWMMLPFHKGGNMGKTTA
SFGIRLYDYLAGVKKNERRKILSAKETLAKNPFVKKDGLKGSGYYVEYRTDDARLTIEVM
KKAVELGANAINYTKAEHFLYDDNKQVVGVTVTDRLSGKAYDIKGHRVINAAGPWVDKVR
KLDYATNNKHLRLTKGIHLVIDKQKFPMEQAVYFDTPDGRMVFAIPRDKKVYVGTTDTVY
DEAVINPKALESDHNYVIKAINYMFPDVHITEKDIESSWAGVRPLIYEEGKDPSEISRKD
EVWFSESGLITMAGGKLTGYRKMAEKLLDDVSKTLAKETGKKYKTVQTKHLPISGGDIGG
SEQLEAFLSKKAKEGNNRFGWTLEEGREMAKRFGSNIDQLFTYAQEHKEQNETTLPNSLY
AELRYSIQHEAVTTPIDFLLRRTGYLLFDMPYLLEWKDAVVDEMAKQFHWSDDVKQTYIE
ELNIQINDAREPADWHDR
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggtacaattattttcagcgtttgacagagaaacaatcgaaagaaatcttcaagaggaa
aaatttgatttagtcatcgtcggtggcgggattacaggggcaggaatcgctttagatgcc
acttcacgaggtatgagtgtcgcacttgttgaaatgggtgatttcgcgagcggaacatcg
agccgttcaacaaaattagtccacggtggattaagatatttacaacaatttgaaattaaa
gaagtagcagatttaggaaaagaacgtgcgatagtctacgaaaatggaccacacgtaacg
actcctgaatggatgatgctcccattccataaaggcggcaatatgggtaaaactaccgct
tcatttggtattcgtttatatgactatttagcaggggtaaagaaaaatgaacgacgtaaa
attttaagcgcaaaagaaacattagccaaaaatccattcgtgaaaaaagacggtttaaaa
ggttctggttactacgtggaataccgcacggatgatgcgcgtctaacaatagaagttatg
aaaaaagcagtagaactcggagcgaatgctattaactatacaaaagcggagcatttctta
tatgatgacaataaacaagtagttggtgtaaccgtaacagatcgtttgtcgggcaaagca
tacgatattaaaggacatcgtgttattaatgctgctggtccttgggtagataaagtaaga
aaattagattatgcaacaaacaacaaacatttacgcttaacaaaaggaattcatttggtt
attgataaacaaaaattcccgatggaacaagcggtatactttgatacacctgatggccgg
atggtctttgctattccgcgcgataaaaaagtgtatgttggaacgacggatacagtgtac
gacgaagcagtaattaatccaaaagcacttgaatctgatcataattatgtgattaaggcg
attaattatatgttccctgatgtgcatattaccgaaaaagatattgaatcaagttgggct
ggggttcgtccacttatctatgaagaaggaaaagatccatctgaaatttcacgtaaagat
gaagtttggttttctgaaagtggcttaatcacgatggcaggtggtaaactcactggttac
agaaaaatggccgaaaaattattagatgacgtttcaaaaacattagcgaaagaaactggt
aaaaagtacaaaacagttcaaacaaaacatttaccaatttctggtggtgacattggtggc
tcagaacaattagaagctttcctatctaaaaaagcgaaagaaggtaataatcgtttcggc
tggactttagaagaaggtcgtgagatggctaaacgtttcggtagtaatatcgatcaatta
tttacttatgcacaggaacataaagaacaaaacgaaaccactttaccaaacagtttgtat
gctgaactacgctactcgattcaacacgaagcagtgacaacgccaatcgatttcttatta
cgtcgcactggctacttgcttttcgatatgccatacttacttgaatggaaagacgctgtt
gtggatgaaatggctaaacaattccactggagcgacgatgtaaaacaaacctatatcgag
gaattaaatattcaaattaatgatgctagagaaccagctgattggcacgatagataa

DBGET integrated database retrieval system