KEGG   Listeria monocytogenes 07PF0776 (serotype 4b): MUO_02785Help
Entry
MUO_02785         CDS       T02040                                 

Definition
(GenBank) polyol (sorbitol) dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
lmp  Listeria monocytogenes 07PF0776 (serotype 4b)
Pathway
lmp00040  Pentose and glucuronate interconversions
lmp00051  Fructose and mannose metabolism
lmp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MUO_02785
   00051 Fructose and mannose metabolism
    MUO_02785
Enzymes [BR:lmp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     MUO_02785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C PALP 2-Hacid_dh_C PrmA TrkA_N Pyr_redox_2 HAD Methyltransf_25 ELFV_dehydrog Pyr_redox Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AFH79102
LinkDB All DBs
Position
546285..547331
Genome map
AA seq 348 aa AA seqDB search
MKALKLYGKRDLRYEEADMPTIEQPDDVILKVKTVGICGSDISRYSKLGPYVPGMVWGHE
FSGEVIEVGSEVTDIEIGDRAAGCPALYCGECEYCKKGEFARCRKLTVIGARHPGAYAEY
IKLPAENVVKIPDELDYEAAALVEPSAVVVHGFYHTKLQAGDDVVVVGSGNIGLLAIQWA
KVFGAKRVIAIDVDDKKLALAKEVGADVVINSLKEDPLEVVAAHTDGLNADLVVEAAGSP
ITSAQVFAYAKKGGGVVFLGIPYADVTIERFYFEKIVRSELTVWGSWNAISAPFPGKEWQ
TTIHFLANKQIKIEPMITHRLSLAEGPEVFERIYERNEFFGKVLFFPE
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctttaaaattatatggaaaaagagatttgcgttatgaagaagcggatatgcca
acaatcgaacagccagatgatgtgattttgaaagtgaaaacggttgggatttgcggatct
gatatttcgagatacagtaaacttggtccgtatgtaccaggaatggtgtggggacatgaa
ttttcaggagaagtgattgaggttggtagtgaggttacagatattgagattggtgatagg
gctgccggatgcccagcactctattgcggagagtgtgaatactgtaaaaaaggcgaattc
gcccgctgtcggaagctaacagtaatcggagcaagacatcccggagcctatgctgagtat
atcaaacttccagcagaaaatgtagtaaaaataccagacgaattagattatgaagctgct
gcacttgtcgagccttccgcagtggtcgttcatgggttttatcatacgaaattacaagca
ggcgatgatgtcgtcgttgtcggaagcggcaatataggtttgctagcaattcaatgggca
aaagtttttggcgcaaaaagagttattgcaattgatgtagacgataaaaagttagctctt
gcaaaagaagtaggagcagacgtcgttattaattctttaaaagaagatccattagaagta
gtcgcagcacatacagatggtctaaacgctgatttagttgtagaagctgcgggatcacct
attacatctgcccaagtttttgcctatgcgaaaaaaggtggaggcgtcgttttcctaggg
attccatacgccgatgtaacaatcgaacgtttctattttgaaaaaattgttcggagtgag
cttactgtttggggctcatggaatgcaatttctgcaccatttccaggaaaagaatggcaa
acaaccattcatttcctagccaataaacaaatcaaaattgaaccaatgattacacatcgt
ctttcacttgctgaaggaccagaagtttttgagcgaatctatgaaagaaatgaatttttc
gggaaagtattatttttcccagaataa

DBGET integrated database retrieval system