KEGG   Listeria monocytogenes 07PF0776 (serotype 4b): MUO_11640Help
Entry
MUO_11640         CDS       T02040                                 

Definition
(GenBank) competence transcription factor
  KO
K02250  competence protein ComK
Organism
lmp  Listeria monocytogenes 07PF0776 (serotype 4b)
Pathway
lmp02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lmp00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    MUO_11640
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lmp03000]
    MUO_11640
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lmp02044]
    MUO_11640
Transcription factors [BR:lmp03000]
 Prokaryotic Type
  Other transcription factors
   Others
    MUO_11640
Secretion system [BR:lmp02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) related proteins
   MUO_11640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ComK SpoIISB_antitox
Motif
Other DBs
NCBI-ProteinID: AFH80845
LinkDB All DBs
Position
2352367..2352975
Genome map
AA seq 202 aa AA seqDB search
MKKEQISTQFYEVNPHTMIIFPKKSGSIVYSEIYEVDSHCTSKFTPFELIKTSCNFFGSS
YEGRKEGTKHLIGVTHKPPIIIDPVTSTYVFPTVAPSSTECIWIFPQHIKDYHAIGFNHT
LITFSNMETFEIDMSLASFNNQIARTSMLHMKFSQKMRIMESNFPSMNRFFPPTTLAAEP
RRYYSTMLPNNEDPNEPQDPEQ
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagaacaaatcagtactcagttttatgaagtaaacccgcacacaatgattatt
tttccaaaaaaatctggaagtatagtctattcagaaatttatgaagttgattcccattgt
acttctaaatttaccccgtttgaactaattaaaaccagctgtaactttttcggatcaagc
tatgagggacgcaaagagggaactaaacacttaattggtgttacccataagccacccatt
atcattgacccagtcacttctacttatgtatttccaactgtagcacctagttcaacagaa
tgtatttggattttcccacaacatattaaagattatcatgcaattggatttaaccacact
ttaataacattttctaatatggaaacctttgagattgatatgtctttagcatcttttaat
aatcagattgctagaacctccatgttacatatgaaattttctcaaaaaatgcgtataatg
gagagtaattttccttcaatgaataggtttttcccaccaaccactcttgctgctgaacct
agacgttattacagcaccatgcttccaaataacgaagatcctaatgagcctcaagatcct
gagcagtaa

DBGET integrated database retrieval system