KEGG   Listeria monocytogenes M7 (serotype 4a): LMM7_1913Help
Entry
LMM7_1913         CDS       T01988                                 

Gene name
pknB
Definition
(GenBank) putative serine/threonine-specific protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
lmq  Listeria monocytogenes M7 (serotype 4a)
Brite
KEGG Orthology (KO) [BR:lmq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lmq01001]
    LMM7_1913 (pknB)
Enzymes [BR:lmq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     LMM7_1913 (pknB)
Protein kinases [BR:lmq01001]
 Serine/threonine kinases: Other
  Bacterial family
   LMM7_1913 (pknB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr Haspin_kinase APH Kdo Kinase-like RIO1 DUF5345 Seadorna_VP7 YukC LPD29 DUF4713
Motif
Other DBs
NCBI-ProteinID: AEH92918
UniProt: A0A0E0UXT4
LinkDB All DBs
Position
complement(1903239..1905206)
Genome map
AA seq 655 aa AA seqDB search
MMIGKRLSDRYKILHAIGGGGMANVYLAHDIILDRDVAVKILRIDLADESNLIRRFQREA
QSATSLVHPNIVSVYDVGEENDLHYIVMEHVDGMDLKQYIHENHPISYEKAVDIMLQIVS
AVAIAHQHHIIHRDLKPQNILIDHDGVVKITDFGIAMALSETSITQTNSLLGSVHYLSPE
QARGGMATQKSDIYSLGIVLYELLTGKVPFDGESAVSIAIKHLQADIPSAREQNPEIPQS
LENIIIKATAKDPFLRYQNAEEMEKDLQTCLNKDRLNEPKYVFPTDDGDTKAIPIIATKD
TMQNLDKTIVPEGKVAAAEAVPEEKKGKKKKKMSKKKKITLIVFSVIAIFIIGILLLWLL
GKSPDEVAVPDVSGKTEDQAVALLQKEGFVIGKTAEKNSDEIAEGKVINTDPEAGEMKEK
GTKINLFVSIGSKKITMDDYTGRSYTDTKAILEQQGFKNISSEEAYSSEVGKGMIISQTP
TQGTEVVAKSTDVKFVVSKGAEPITLKDLRGYTKTAVEDYASPLGLKVSSKEENSSTVEK
GQVISQSPSAGTAMNAGDTIEIVISAGPKEKQVKEVTKTFNIPYTPSDEDNPQPQKVQIY
IQDKDHSMTSAYREMSITQNTSVEITFQIEEGSSAGYKIISDDKVIDEGTVPYPN
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgatgattggtaagcgattaagtgatcgatataagattttacatgcaataggtggcggc
ggaatggccaatgtgtacttggcgcatgatattattcttgatagagatgttgcagtgaaa
attttacgaatcgatttggcagatgaaagcaaccttattcgtcggttccaacgagaagct
caatcagcaacaagtctcgttcaccctaatattgttagtgtgtacgatgttggtgaagaa
aatgatttacactatattgtaatggaacatgtagatgggatggatttaaaacagtacatt
cacgaaaatcatccaatcagttatgaaaaagcagttgatattatgctgcaaatcgtttct
gcggtagcaatcgcccatcaacatcacattatccaccgtgacttaaaaccgcaaaatatt
ttaattgatcatgatggtgttgtgaagattacagattttggtattgcaatggcactttca
gaaacatctattacacaaacgaattctttactaggttcggtgcattacttatccccagaa
caagcacgtggcggaatggcaacgcaaaaatcagatatctattcacttggcattgtgtta
tacgaactattaactggaaaagtaccttttgacggggagtcagcagtttctatagctatt
aagcatctgcaagcagacatcccatccgcaagagaacaaaatccagaaattccacaaagc
ttagaaaatattattattaaagcaacggctaaagatccatttttacgctatcaaaacgca
gaagaaatggaaaaagacttgcaaacttgtttaaataaagaccgtttgaacgaacctaaa
tatgttttcccaacagatgatggtgatacgaaagcaattccaatcatcgcaaccaaagac
acgatgcaaaaccttgataaaaccattgtcccagaaggaaaagtagcagcagctgaagca
gttcctgaagagaaaaaaggcaagaaaaagaaaaaaatgagcaagaaaaagaaaattaca
ttaatcgttttttccgttattgccatttttatcattggtattttattactgtggctacta
ggcaagagtcctgatgaggttgctgtgccggatgtttctggtaaaacagaagaccaagca
gtagccctacttcaaaaagaaggctttgtcattggcaagaccgcagaaaaaaatagcgat
gaaatagcagaaggaaaagtaattaatacggaccctgaagccggtgaaatgaaagaaaaa
ggaacaaaaattaatttattcgtaagtattggttcgaaaaaaataacgatggatgactac
acgggaagaagttacacagataccaaagcaatcctcgaacagcaaggatttaagaatatt
tcttcagaggaagcctatagttcagaagttggaaaaggtatgattattagccaaacacca
acccaaggaacagaagtagttgctaaatcaaccgatgtgaaattcgtcgtaagtaaaggt
gcagaaccaattacactgaaagatttacgaggttacactaaaacggcagtagaagactac
gcttcaccgcttggacttaaagtttcaagtaaagaagaaaactcaagcactgttgaaaaa
ggacaagttatttcgcagtctccatctgctggaacggcaatgaacgctggagatacgatt
gagattgtcatttctgcaggaccaaaagaaaaacaagtcaaagaagtaacaaaaacattt
aacatcccatatacaccaagtgatgaagacaacccacaaccacagaaagtgcaaatttac
attcaagataaagaccatagcatgacgagcgcttaccgagaaatgagcattacacaaaat
acctcggtagaaataactttccaaattgaagaaggttctagcgcaggctacaaaatcatc
agtgatgataaagtaatcgatgaaggtacagtcccttatccaaattaa

DBGET integrated database retrieval system