KEGG   Listeria monocytogenes M7 (serotype 4a): LMM7_2322Help
Entry
LMM7_2322         CDS       T01988                                 

Definition
(GenBank) 3'-5' exoribonuclease YhaM
  KO
K03698  3'-5' exoribonuclease [EC:3.1.-.-]
Organism
lmq  Listeria monocytogenes M7 (serotype 4a)
Brite
KEGG Orthology (KO) [BR:lmq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lmq03019]
    LMM7_2322
Enzymes [BR:lmq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     LMM7_2322
Messenger RNA biogenesis [BR:lmq03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     LMM7_2322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HD tRNA_anti-codon
Motif
Other DBs
NCBI-ProteinID: AEH93327
UniProt: A0A0E0UY02
LinkDB All DBs
Position
complement(2326818..2327804)
Genome map
AA seq 328 aa AA seqDB search
MGEETSYYRKKEGDTMEKRLLDFEVGETVDLFLLIKSSVKGTASNGKPFLSLVLQDKSGE
LEAKLWDVKESDEANYGVQQIVHLMGDIQNYRGRKQLKIRQIRQATALDGVSASEFMETA
PINKEEMADEITQYIFEMKNANLQRITRALLKKYQDDFYDYPAAMRHHHEFVSGLSFHVV
SMLRLAKSVADLYPSVNRDLLYAGVILHDLGKVIELSGPVSTTYTLEGNLIGHISIVVEE
VSKIADELSIDGEEVVVLKHVLLSHHGKGEWGSPKPPLVREAEILHQIDLMDASLNMMDK
VLKHTKPGEFSERVFGLDNRSFYNPTFE
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaagaaacttcttactacagaaagaaagaaggcgatacaatggaaaaaagatta
ttagactttgaagttggggaaacagtagacttattcttgctaattaaatcaagcgtaaaa
ggaacggctagcaacggaaagcccttcttgagccttgtcttgcaagataaatcaggtgaa
ttagaggcaaaactatgggatgttaaagaaagcgatgaagcgaattacggggtacaacaa
atagttcatcttatgggtgacattcaaaattatcgtggtcgtaaacaattgaaaatccgt
caaattagacaggctacagcgctggatggtgttagtgccagtgaattcatggaaaccgcg
ccaattaataaagaagaaatggccgatgaaattacacaatatatttttgaaatgaaaaat
gcaaacttacaacgaattacgcgcgcgctgttaaaaaaatatcaagatgatttttatgat
tatccggcagcaatgcgtcatcaccatgaatttgtttctggtttgagcttccatgtagtt
tcgatgctacgtcttgcaaaatcggtcgctgatctatacccatctgttaatcgggattta
ttgtacgcaggtgtgattttacatgacttagggaaagttattgaactttctggcccagta
tcaacgacatacacactagaaggtaatttaattggtcatatatctatcgtagtggaagaa
gttagtaaaattgctgacgaactttcgattgatggtgaagaagtcgttgtattaaaacat
gttcttctttctcatcacggcaaaggtgaatggggtagcccaaaaccaccacttgtgcgt
gaagcagagattttacaccaaattgatttaatggatgcatctttgaacatgatggataaa
gtattaaaacatacaaaacctggtgaattcagtgaacgagtatttggattagacaaccgt
tcattttataatcctacatttgaataa

DBGET integrated database retrieval system