KEGG   Listeria monocytogenes M7 (serotype 4a): LMM7_2404Help
Entry
LMM7_2404         CDS       T01988                                 

Gene name
gadD2
Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lmq  Listeria monocytogenes M7 (serotype 4a)
Pathway
lmq00250  Alanine, aspartate and glutamate metabolism
lmq00410  beta-Alanine metabolism
lmq00430  Taurine and hypotaurine metabolism
lmq00650  Butanoate metabolism
lmq01100  Metabolic pathways
lmq01110  Biosynthesis of secondary metabolites
lmq01120  Microbial metabolism in diverse environments
lmq02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lmq00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    LMM7_2404 (gadD2)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LMM7_2404 (gadD2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LMM7_2404 (gadD2)
   00430 Taurine and hypotaurine metabolism
    LMM7_2404 (gadD2)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    LMM7_2404 (gadD2)
Enzymes [BR:lmq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     LMM7_2404 (gadD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC DUF3826
Motif
Other DBs
NCBI-ProteinID: AEH93409
UniProt: A0A0E0UYL5
LinkDB All DBs
Position
2411979..2413373
Genome map
AA seq 464 aa AA seqDB search
MLYSKENKESYLEPVFGSSAEDRDIPKYTLGKEPLEPRIAYRLVKDELLDEGSARQNLAT
FCQTYMEDEATKLMSETLEKNAIDKSEYPRTAELENRCVNIIADLWHAPKDQKFMGTSTI
GSSEACMLGGMAMKFAWRKRAEKLGLDIYAQKPNLVISSGYQVCWEKFCVYWDIDMRVVP
MDKDHMQLNTDQVLDYVDEYTIGVVGILGITYTGRYDDIYALNEKLEEYNSKTDYKVYIH
VDAASGGFFTPFVEPDIIWDFRLKNVISINTSGHKYGLVYPGIGWVLWKDESYLPEELIF
KVSYLGGEMPTMQINFSRSASHIIGQYYNFLRYGFEGYRTIHQKTSDVAQYLAHAVEQTG
YFDIYNDGSHLPIVCYKLKDDANVKWTLYDLADHLQMRGWQVPAYPLPKNLENIIIQRYV
CRADLGFNMAEEFIQDFQASIQELNNAHILFHDTQQSGVHGFTH
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgttatatagtaaagaaaataaagaaagttatttagaaccagttttcggatcaagtgca
gaggatcgtgatattcctaaatataccctcggaaaagaaccactcgaacctcggattgcc
tatcgtttagtaaaagatgaacttttagatgaaggttctgcccgccaaaacttagctact
ttttgccaaacatatatggaagacgaagcaaccaagttaatgtccgaaacactagaaaaa
aatgcgattgataaatccgaatatcctagaacagccgaactagaaaatcgttgcgtcaat
attatcgctgacttgtggcatgcacctaaagaccaaaaattcatgggaacttccacaatc
ggctctagtgaagcgtgtatgcttggcggaatggcaatgaaatttgcttggagaaaacgt
gcggaaaaacttggcttagatatttatgcgcaaaaaccaaacctcgttatctcttctggc
tatcaagtatgctgggaaaaattctgtgtctactgggatatcgatatgcgcgttgttcca
atggataaagaccacatgcaactaaatactgaccaagtccttgattacgtcgacgaatat
acaatcggcgttgtcggcatcctcggcatcacttacacaggccgctacgatgacatctat
gcacttaacgaaaaattagaagaatacaatagcaaaacagattataaagtctacattcac
gtcgatgcagcaagtggcggattcttcacaccatttgtcgaacccgatatcatctgggac
ttccgcttgaaaaacgttatctccattaatacttctggtcacaaatacggcctcgtttat
ccaggtatcggttgggtcctttggaaagatgaaagctacctaccagaagaactcatcttt
aaagttagctatcttggcggagaaatgccaaccatgcaaatcaatttctcccgcagcgcc
agccacatcatcggtcaatactacaatttcttacgctacggcttcgaaggctaccgcacc
attcaccaaaaaacaagcgatgtcgcacaataccttgctcatgcagtcgaacaaaccggc
tactttgacatttataacgacggctcccatttaccaatcgtctgctataaattaaaagac
gacgctaacgtaaaatggacattatatgatttagcggaccacctccaaatgcgcggctgg
caggttcccgcatacccactaccaaaaaacttagaaaacatcatcatccaacgttacgtc
tgccgagctgacctcggtttcaacatggcagaagaattcatccaagatttccaagcctct
attcaagaactaaacaacgcccacattctcttccacgatacccaacaatccggcgtccac
ggcttcacacattaa

DBGET integrated database retrieval system