KEGG   Listeria monocytogenes R479a (serotype 1/2a): LMR479A_1060Help
Entry
LMR479A_1060      CDS       T03180                                 

Definition
(GenBank) putative transketolase C-terminal section
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
lmr  Listeria monocytogenes R479a (serotype 1/2a)
Pathway
lmr00030  Pentose phosphate pathway
lmr01100  Metabolic pathways
lmr01110  Biosynthesis of secondary metabolites
lmr01120  Microbial metabolism in diverse environments
lmr01130  Biosynthesis of antibiotics
lmr01200  Carbon metabolism
lmr01230  Biosynthesis of amino acids
Module
lmr_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
lmr_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:lmr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LMR479A_1060
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    LMR479A_1060
Enzymes [BR:lmr01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     LMR479A_1060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_C Transket_pyr PFOR_II
Motif
Other DBs
NCBI-ProteinID: CDM16282
LinkDB All DBs
Position
1040473..1041429
Genome map
AA seq 318 aa AA seqDB search
MNKIANRQVMCEVLMKEATRNDSNLVVLTSDSRGSASLGAFAEKFPERLIETGIAEQNIV
GIAAGLAHSGKRAFVASPACFLSMRSIEQVKVDVAYSDTNVKLIGISGGVSYGALGMSHH
SLQDIAVTRAIPNLEVILPADRLETEAIFDYLLQSNRPAYVRLGRNAVEDCYAEKPVFQI
GKAGTLREGNDVSILATGEMVRVALDASEELKLKGISARVLNFSTIKPFDQEVVKAALTE
TKLLISIEEHSIYGGLGAAVSEVVSSSPTSIRHLILGIPDEPAIAGTSQEIFDYYGLSAT
GIVATIMKNLPIIGDERR
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaatagcgaaccgccaagtaatgtgtgaagttttaatgaaagaagcaactcgt
aacgatagtaatttagttgttttaacaagtgattcaagaggatccgcttcgctgggggct
tttgctgagaaatttccagagcgattaattgaaactggtattgccgaacaaaatattgtt
ggaattgcagcaggtttagcacatagtggcaaacgagcttttgtcgcttcaccagcttgt
tttctaagtatgcgcagtattgaacaggtgaaagtagacgtggcttattcagacacaaat
gtaaaattgattggcatcagcggtggtgttagttatggtgcacttggtatgagccatcat
tcgcttcaagatattgctgttactagagcgattcctaatttagaagtcattctaccagct
gatcgtctggaaactgaagctatttttgactatttgcttcaatcaaatcggccggcgtac
gttcgtcttggcagaaatgcggtagaagattgttacgcagaaaaaccagtatttcaaatt
gggaaagctggaactcttagggaaggaaacgatgtgtcaattttagcaactggtgaaatg
gtacgtgtcgcacttgatgcaagtgaagaattgaagttgaaaggaatcagcgcacgcgta
ttgaatttttcaacaatcaaaccatttgaccaggaagtagtaaaagcggcattaactgaa
acgaaactacttattagcatagaagaacatagcatttatggtggcttaggtgcagcagtg
agcgaagtggtaagtagttcgccaacaagtattcgtcatttgattttaggaattccagat
gaacccgctatcgctggaacgagccaagaaatttttgattattatggcttatctgctact
ggtattgttgctacaatcatgaaaaacctaccgatcattggagacgaaagaagatga

DBGET integrated database retrieval system