KEGG   Listeria monocytogenes R479a (serotype 1/2a): LMR479A_1082Help
Entry
LMR479A_1082      CDS       T03180                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase (dihydrolipoamide acetyltransferase E2 subunit)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lmr  Listeria monocytogenes R479a (serotype 1/2a)
Pathway
lmr00010  Glycolysis / Gluconeogenesis
lmr00020  Citrate cycle (TCA cycle)
lmr00620  Pyruvate metabolism
lmr01100  Metabolic pathways
lmr01110  Biosynthesis of secondary metabolites
lmr01120  Microbial metabolism in diverse environments
lmr01130  Biosynthesis of antibiotics
lmr01200  Carbon metabolism
Module
lmr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lmr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMR479A_1082 (pdhC)
   00020 Citrate cycle (TCA cycle)
    LMR479A_1082 (pdhC)
   00620 Pyruvate metabolism
    LMR479A_1082 (pdhC)
Enzymes [BR:lmr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LMR479A_1082 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding HlyD_3 NQRA RnfC_N GCV_H HlyD_D23 HlyD_2 DUF896
Motif
Other DBs
NCBI-ProteinID: CDM16304
LinkDB All DBs
Position
1059548..1061182
Genome map
AA seq 544 aa AA seqDB search
MAYSFKLPDIGEGIHEGEIVKWFVQPGDKIEEDESLFEVQNDKSVEEITSPVSGTIKEIK
VAEGTVATVGQVLVTFDGVEGHEDDAEEESAAPKAESTESTPAPAQASGKGIFEFKLPDI
GEGIHEGEIVKWFIQPGDKVEEDQSIFEVQNDKSVEEITSPVDGTVKDILVSEGTVATVG
QVLVTFEGDFEGEASHESTPESPAEDAALANNDATSAPATGGNGTPSSKKDPNGLVIAMP
SVRKYAREKGVNIAEVAGSGKNNRVVKADIDAFLNGEQPAAATTTAQTEEKAAAPKAEKA
AAKQPVASSDAYPETREKLTPTRRAIAKAMVNSKHTAPHVTLMDEIEVTALMAHRKRFKE
VAAEKGIKLTFLPYMVKALVATLRDFPVLNTTLDDATEELVYKHYFNVGIAADTDHGLYV
PVIKNADKKSVFQISDEINELAGKARDGKLTADEMRHGSATISNIGSAGGQWFTPVINYP
EVAILGVGRIAQKPIVKDGEIVAAPVLALSLSFDHRVIDGATAQKAMNNIKRLLNDPELL
LMEV
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atggcatattcatttaaattaccggatatcggtgaaggtatccatgaaggtgaaatcgtt
aaatggtttgtacaaccaggcgataaaattgaagaagatgaatccctatttgaagtacaa
aacgacaaatcagtggaagaaatcacttctccagtttcaggaacaattaaagaaatcaaa
gttgctgaaggtacagttgctacagttggacaagtactagtaacgtttgatggcgtagaa
ggtcacgaagacgacgccgaagaagaaagcgcagcaccaaaagcagaatccacagaatca
actcctgcacccgcacaagctagcggaaaaggaatttttgaattcaaattaccagatatt
ggtgaaggaattcatgaaggtgaaattgttaaatggtttattcaaccgggcgataaagta
gaagaagatcagtccatttttgaagtacaaaacgacaaatctgtcgaagaaattacttct
ccagtagatggtactgttaaagatattttagttagcgaaggaacagtagcaacagttggt
caagtattagtaacattcgaaggtgattttgaaggagaagcaagccatgaatctactcca
gaatctccagcagaagacgctgcacttgctaacaacgatgcaacttccgcaccagcaaca
ggtggaaacggaactccatcatctaaaaaagatcctaatggccttgtaattgcaatgcct
tctgtacgtaaatatgcgcgtgaaaaaggcgttaatatcgctgaagtagcaggctctgga
aaaaataaccgcgtagttaaagctgatattgatgctttcctaaacggcgaacaaccagct
gcagcaacaactactgctcaaacagaagaaaaagcagctgcaccaaaagcagaaaaagca
gcagcaaaacaaccagttgcaagctccgatgcttacccagaaacacgcgaaaaattaaca
ccaactcgtcgtgcaattgcaaaagcaatggtaaactcaaaacatacagctccacacgtt
actttaatggacgaaatcgaagtaactgcacttatggctcaccgcaaacgtttcaaagaa
gtggctgccgaaaaaggtatcaaactaactttcttaccttatatggtgaaagctcttgtt
gcaacgcttcgtgacttcccagtgcttaacacaactttagatgatgcgacagaagaactt
gtttacaaacattacttcaacgttggtatcgcagcagatacagaccacggtttatatgta
ccagtaattaaaaatgctgataaaaaatccgtattccaaatttctgatgaaatcaacgaa
ctagctggaaaagcacgtgatggtaaattaactgctgacgaaatgcgccacggttccgca
actatttctaatatcggttctgccggcggacaatggttcactccagtaattaattaccca
gaagttgctattctaggtgttggtcgtattgcccaaaaacctatcgtaaaagatggcgaa
attgtagcagcaccagtactagctctttccttgagctttgaccaccgtgtaattgacggc
gcaactgctcaaaaagcaatgaacaatattaaacgtttattgaacgatccagaattatta
ctaatggaggtgtaa

DBGET integrated database retrieval system