KEGG   Listeria monocytogenes R479a (serotype 1/2a): LMR479A_1960Help
Entry
LMR479A_1960      CDS       T03180                                 

Gene name
ypoP
Definition
(GenBank) Uncharacterized HTH-type transcriptional regulator ypoP
Organism
lmr  Listeria monocytogenes R479a (serotype 1/2a)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR HTH_27 MarR_2 TrmB B-block_TFIIIC TFIIE_alpha HTH_24 Fe_dep_repress Rrf2
Motif
Other DBs
NCBI-ProteinID: CDM17176
LinkDB All DBs
Position
complement(1933673..1934089)
Genome map
AA seq 138 aa AA seqDB search
METYLEIETLIKRIFNSFRHEVEAVLDKRLSGSEYRVLSLISSGLTKTSELAKTLDVSAS
HITAITDTLVEEELITRHRSEVDRRIIELKLTPNAEEFVKEIDKKKKEMIVKRFAVFSEY
EQAEFRKLLKKLADGSIK
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atggaaacatacttagaaattgaaacattgattaagcgaatttttaatagttttcgtcat
gaagtagaggcagtactcgacaaaaggttaagtggtagcgagtatcgggtcttaagcttg
atttcaagtggacttacgaaaacatctgaattagctaaaacgcttgatgtttcagccagt
cacatcacagccattacggatactttagtcgaagaagagcttattacacgacatcgttcg
gaagtagaccgccgaattattgaactgaaattaaccccaaacgccgaggaatttgtcaaa
gaaattgataaaaagaaaaaagaaatgattgtaaaacgttttgccgttttttctgagtat
gaacaagcagagttccgcaaactgctcaaaaaattagcagacggatcaattaaataa

DBGET integrated database retrieval system