KEGG   Listeria monocytogenes Finland 1998: LMLG_1481Help
Entry
LMLG_1481         CDS       T01986                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
lms  Listeria monocytogenes Finland 1998
Pathway
lms00970  Aminoacyl-tRNA biosynthesis
lms01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lms00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LMLG_1481
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lms03029]
    LMLG_1481
Enzymes [BR:lms01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     LMLG_1481
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     LMLG_1481
Mitochondrial biogenesis [BR:lms03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    LMLG_1481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln DUF1152
Motif
Other DBs
NCBI-ProteinID: AEO39285
LinkDB All DBs
Position
complement(1806478..1806771)
Genome map
AA seq 97 aa AA seqDB search
MSNISKETVEKVANLAKLEVSETEATAFAGQLGKIIELVEQLNTLDTTNVEPTSHAIDVS
NVLREDVATKGLDRKEVLKNAPDEQDGMFKVPTIMEQ
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
ttgtcaaatatatcaaaagaaacagtagaaaaagtagcaaatcttgccaaactagaagta
tcagaaacagaagcaactgctttcgctggtcagcttggtaaaattattgagctagtagag
caattaaatactttagatacaacgaatgtagaacctaccagccatgcaatcgacgtatca
aacgttttacgtgaagatgtagcaacaaaagggttagatcgtaaagaagtactaaaaaat
gccccagatgagcaagacggcatgttcaaagtaccgacaattatggaacaataa

DBGET integrated database retrieval system