KEGG   Listeria monocytogenes Finland 1998: LMLG_1758Help
Entry
LMLG_1758         CDS       T01986                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lms  Listeria monocytogenes Finland 1998
Pathway
lms00010  Glycolysis / Gluconeogenesis
lms00030  Pentose phosphate pathway
lms00051  Fructose and mannose metabolism
lms00052  Galactose metabolism
lms00680  Methane metabolism
lms01100  Metabolic pathways
lms01110  Biosynthesis of secondary metabolites
lms01120  Microbial metabolism in diverse environments
lms01130  Biosynthesis of antibiotics
lms01200  Carbon metabolism
lms01230  Biosynthesis of amino acids
lms03018  RNA degradation
Module
lms_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lms00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMLG_1758
   00030 Pentose phosphate pathway
    LMLG_1758
   00051 Fructose and mannose metabolism
    LMLG_1758
   00052 Galactose metabolism
    LMLG_1758
  09102 Energy metabolism
   00680 Methane metabolism
    LMLG_1758
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    LMLG_1758
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lms01009]
    LMLG_1758
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lms03019]
    LMLG_1758
Enzymes [BR:lms01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LMLG_1758
Protein phosphatases and associated proteins [BR:lms01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LMLG_1758
Messenger RNA biogenesis [BR:lms03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     LMLG_1758
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AEO39100
LinkDB All DBs
Position
complement(1590329..1591288)
Genome map
AA seq 319 aa AA seqDB search
MKRIAILTSGGDAPGMNAATRAVVRKAIYEGLEVYGINYGFLGLVNGDIRKLELGSVGDL
LHRGGTFLYSARYPEFATEEGQLKGIEQLKKHQIDGLVVIGGDGSYHGAEALTKRGFPTI
GIPGTIDNDISGTDFTIGFDTALNTVLDALDKIRDTATSHERTFIIEVMGRDAGDIALWS
GLAGGAEAIIVPEESFNMDDVVDRLNKGRERGKKHSIIVVAEGVMSGNEFAKQLAEYGDY
HARVTVLGHVQRGGSPTAFDRVLASRLGARSVELLLENRGGLAVGIRENRIVENDISEIL
KEKHTLDQKLFDLASILSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaattgcaattttaacaagtggaggagacgctccaggaatgaatgcagccact
cgtgctgttgtacggaaagcaatctatgaaggacttgaagtttacggtattaactatggc
tttttagggctagtcaatggcgatattcgtaaactagaattaggttctgttggtgattta
cttcaccgcggaggtacattcctttattccgcaagatatcctgaattcgctacagaagaa
ggacaacttaaaggaattgaacaattgaaaaaacatcaaatcgatggcctagttgttatc
ggtggagatggttcttatcacggagcggaagcacttacaaaacgtggattcccaactatt
ggtatcccaggaacaattgataatgatatttctggaactgattttactattggttttgat
actgcattaaatactgttcttgatgcacttgataaaatccgcgatacagctacaagtcac
gaacgtactttcattattgaagttatgggtcgcgacgctggtgatatcgctctttggtct
ggtcttgctggtggcgctgaagctatcatcgttccagaagaaagttttaatatggatgat
gtcgtggatcgtttgaacaaaggtcgcgaacgtggcaaaaaacatagtattatcgtcgta
gctgaaggcgtaatgtctggtaatgaatttgctaaacaattagctgaatatggcgattat
catgcacgtgtaactgttcttggacacgttcaacgtggtggtagcccgactgcatttgac
cgtgtacttgcaagtcgtcttggtgcacgttcagtagaattattgctagaaaaccgcgga
ggattagctgttggaatccgtgaaaatagaattgtcgaaaatgacattagtgagattttg
aaagaaaaacacactcttgatcaaaaattatttgatcttgcatcaattttgtcgatttaa

DBGET integrated database retrieval system