KEGG   Listeria monocytogenes Finland 1998: LMLG_1800Help
Entry
LMLG_1800         CDS       T01986                                 

Definition
(GenBank) queuine tRNA-ribosyltransferase
  KO
K00773  queuine tRNA-ribosyltransferase [EC:2.4.2.29]
Organism
lms  Listeria monocytogenes Finland 1998
Brite
KEGG Orthology (KO) [BR:lms00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lms03016]
    LMLG_1800
Enzymes [BR:lms01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.29  tRNA-guanosine34 transglycosylase
     LMLG_1800
Transfer RNA biogenesis [BR:lms03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    LMLG_1800
 Prokaryotic Type
    LMLG_1800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TGT
Motif
Other DBs
NCBI-ProteinID: AEO39059
LinkDB All DBs
Position
complement(1545264..1546403)
Genome map
AA seq 379 aa AA seqDB search
MSAIRYELIKTDKQTGARLGKIHTPHGTFDTPMFMPVGTLATVKTMSPEELKAMGAGIIL
SNTYHLWLRPGEELIREAGGLHKFMNWDQPILTDSGGFQVFSLSKMRDIKEEGVHFRNHL
NGDKLFLSPEKAIQIQNALGSDIMMSFDECPPYPASHEYMKKSVERTSRWAERGLKAHVR
PEDQGLFGIVQGGAYEDLRAQSAKDLVSLDFPGYSIGGLSVGEPKDVMNRVLEHTTPLLP
ANKPRYLMGVGSPDSLIDGVIRGVDMFDCVLPTRIARNGTCMTSSGRLVIKNAKFTHDFR
PIDENCDCYTCKNYSRAYIRHLIRCEETFGIRLTTYHNLHFLLNLMKQVRGAIMEDRLAD
FREEFFEQYGFNRPDAKNF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccattcgttatgaactaattaaaacagataaacaaacaggtgctcgtcttggt
aaaatccatacaccgcacggcacatttgatacacctatgtttatgccagttggcacgctt
gcgacggtaaaaacaatgtcacccgaagaattaaaagccatgggtgcaggtattatttta
agcaatacgtatcatttatggttgcgtcccggagaagaacttattcgagaagcgggcgga
ctacataaatttatgaactgggatcaaccaatcttaacggattcaggtggttttcaggtg
tttagtttgagtaaaatgcgtgatatcaaagaagaaggcgttcatttccggaaccattta
aacggggacaaacttttcttatcaccagaaaaagcgattcaaattcaaaatgcacttggt
tcggatattatgatgagttttgacgaatgtccaccatatccagcgtcgcatgaatatatg
aaaaaatcagtagaaagaacatctcgctgggctgaacgcggcttaaaagcgcacgttaga
ccagaagaccaaggtttgttcggtatcgtccaaggtggagcttacgaagatttacgtgcg
caaagtgcgaaagatctcgtttcgcttgattttcctggttattccatcggcggcttatca
gtaggggaaccaaaagatgtcatgaaccgagttttggaacatacgacaccgctattacca
gcaaataaaccacgttatttaatgggcgtaggttcgcctgactcattgattgatggcgtg
attcgaggagtggacatgtttgactgtgttcttcccacacgtattgcacgaaatggtact
tgtatgacatctagtggtcgcttagttattaaaaacgctaagttcacacacgatttccgt
ccaattgatgaaaattgtgattgttatacatgtaaaaattactcgcgtgcatacatccga
cacttgattcgttgtgaagaaacatttggaattcgacttacaacttatcataatcttcat
tttctgttaaacttaatgaagcaagttcgtggcgctattatggaagatcgtcttgctgat
tttagggaagaattttttgagcaatatggattcaatcgtcctgatgcaaaaaatttctaa

DBGET integrated database retrieval system