KEGG   Listeria monocytogenes Finland 1998: LMLG_1801Help
Entry
LMLG_1801         CDS       T01986                                 

Definition
(GenBank) preprotein translocase
  KO
K03210  preprotein translocase subunit YajC
Organism
lms  Listeria monocytogenes Finland 1998
Pathway
lms02024  Quorum sensing
lms03060  Protein export
lms03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:lms00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    LMLG_1801
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    LMLG_1801
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    LMLG_1801
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lms02044]
    LMLG_1801
Secretion system [BR:lms02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   LMLG_1801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YajC Orf78 T2SSM Chordopox_G3 NTPase_P4
Motif
Other DBs
NCBI-ProteinID: AEO39058
LinkDB All DBs
Position
complement(1544901..1545230)
Genome map
AA seq 109 aa AA seqDB search
MGGIVTFIPIILMIVLFYFLLIRPQQKRQKEVQNMQSSLAKGDKIITIGGLHGIVEAIED
GTVILKCGNSKLTFDRNAIRTVLEKGNAVSNPVVAETTSDDTEVVEDNK
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgggcggtattgtaacatttataccaattatcttgatgatcgttttgttttacttctta
ttaattagacctcaacaaaaacgtcaaaaagaagtacaaaatatgcaaagtagtttagca
aaaggtgataaaattattactattggtggacttcacggtattgttgaagcaattgaagat
ggcacagtcattttgaaatgtggaaacagcaaattaacttttgaccgtaacgcaatcaga
actgtacttgaaaaaggtaatgcagtttctaatccagttgtagcagaaacaacttctgat
gacactgaagttgtagaagacaacaaataa

DBGET integrated database retrieval system