KEGG   Listeria monocytogenes Finland 1998: LMLG_1805Help
Entry
LMLG_1805         CDS       T01986                                 

Definition
(GenBank) single-stranded-DNA-specific exonuclease RecJ
  KO
K07462  single-stranded-DNA-specific exonuclease [EC:3.1.-.-]
Organism
lms  Listeria monocytogenes Finland 1998
Pathway
lms03410  Base excision repair
lms03430  Mismatch repair
lms03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:lms00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    LMLG_1805
   03430 Mismatch repair
    LMLG_1805
   03440 Homologous recombination
    LMLG_1805
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lms03400]
    LMLG_1805
Enzymes [BR:lms01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     LMLG_1805
DNA repair and recombination proteins [BR:lms03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    RecJ
     LMLG_1805
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     LMLG_1805
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      LMLG_1805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ssDNA-exonuc_C RecJ_OB DHHA1 DHH
Motif
Other DBs
NCBI-ProteinID: AEO39054
LinkDB All DBs
Position
complement(1539206..1541557)
Genome map
AA seq 783 aa AA seqDB search
MIHSKYLWNIEEAAEDKASQLAEQLKISLPLAKLLWKRKITTQGQFDKFFHPEKYESYDP
FLFAEMDLAVARIKQAIERNEQILVYGDYDADGVTSIAVLMKTLRHLGADADFYIPNRFT
EGYGPNIAAFDMAKNQGTDLIITVDNGIAALEVMAHAKEIGLDVIVTDHHEPREIMPEAV
AVIHPKHPKSAYPFDELAGVGVAYKLSHALLGEEPKELLDLVAVGTVADLVSLTDENRLL
VQLGLRQLRESANLGLAVLAKKASLKLEEATEETIGFGLAPRLNAVGRLGPADPAADLLL
TEDPEEALFLAEEIDDANKERKQIVVDTTKLAMEAIEAKDTLGNVLVVYGEGWNTGILGI
VASKLVGTYSRPAIVLGIDPVTGIAKGSGRSVDAFHLYQALDKHRDLMMAFGGHPMAAGL
TLLAENLTELEAKLQEEASYLSEEDFRPALKIEEKIKLADVSVAFIAQLEKLAPFGMDNP
KPIFLLENMHLKGTKRIGADKTHLKTMLATEENDATLDSIGFGVGDLVDKISPTAAVDVV
GELSINEWNNVKKPQLRMMDIHISHWQLFDVRNKSEWARILQEQTESRVFVCFEERTIGT
LGEQNYILVNEKADFVADFQTEELVFADMPTNIELVETIVRETKPERIFVHFDAAEGNQI
PAIPDRLAFAELYSLIKKFQPFPIEKYTPRLMQKFGWNKEQIDFMSKVFFDLEFAKMDSG
QIIINEVVEKRNLDESLVYQQKVEEITTRKKLLYSNYTELHSWMKSMMETSIYPNAEELE
NGN
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
gtgattcattcaaaatacttatggaatatcgaggaagcggcggaagataaagcaagtcaa
ttagcagaacagctaaaaatctcgcttccacttgcaaaactactttggaaaagaaaaatt
acaacgcaaggacaattcgataaatttttccacccagaaaaatatgaaagctatgacccg
tttttattcgcagagatggatcttgcggttgctagaattaagcaagcgatagaacgaaat
gagcagattttagtttatggagattatgatgcagatggggttactagtattgcagtttta
atgaaaacattgcggcatttaggagccgatgctgatttttatattcctaatcgctttacg
gaaggttatggcccgaatattgccgcttttgatatggctaaaaaccaaggaacagattta
attattacggttgataatggtattgcggcgcttgaagtaatggctcatgccaaagagatt
ggtttagatgttattgttacggatcaccatgaaccgcgtgagattatgccagaagctgtg
gctgttatccacccaaagcatcctaaatcagcttatccgtttgatgaactagcgggtgtg
ggtgttgcttacaaattatcgcacgctttacttggagaagagccaaaagaactgctcgat
ttagttgcagttgggactgtggcagatttagtttctttaacagatgaaaatcgcttactt
gttcaactgggattgcgtcaattacgcgaatccgccaaccttggactggctgtgctagct
aaaaaagctagtttgaaattagaagaggctacggaagaaacgattggctttggtttggca
ccacgactgaatgcagttggtcgattaggcccagcagatccagcggctgatttactttta
acggaagatccagaagaggcacttttcttagcggaagaaatcgatgatgcgaataaggaa
cggaaacaaatagttgttgatacaacaaagctcgcgatggaggcaattgaggcaaaagac
actttaggaaatgtgctcgttgtttacggtgaggggtggaataccggaatccttggaatt
gttgcttctaaattagttggaacatattctcgaccggcaattgtgttggggattgatcct
gtaactggaattgctaaagggtctggtcgaagtgtggacgcgtttcatttatatcaagcg
cttgataaacatcgtgatttaatgatggccttcggtgggcatccaatggctgcaggcctt
acattgctagccgaaaacctaactgaattagaagctaaattacaagaagaagcgagttat
ctttcagaagaagattttcgcccggccttgaaaatagaagaaaaaattaagcttgctgat
gtttcggtggcctttattgctcaacttgaaaaattagcgccttttgggatggataatcct
aaaccgattttcttgttagaaaacatgcatttaaaaggaacgaaaagaattggggcagat
aaaacccatttaaaaacaatgctcgccacagaggaaaatgatgccactttagactctatt
ggatttggcgtaggagatttggtagataaaatttctccgacagcagccgtggatgtggtt
ggagaattgtccatcaatgaatggaacaatgtgaaaaaaccgcaactacgaatgatggat
attcacatttcgcactggcaactctttgatgtacgtaataaatcagagtgggctaggata
ctccaagaacaaacagaatcaagagttttcgtttgttttgaagaaagaacgattggtacg
cttggagaacaaaactatattttggtgaatgaaaaagctgattttgtggcagatttccag
acagaagaacttgttttcgcagatatgccaacgaatatcgaattagttgaaacgattgtt
cgcgaaacgaaaccagagcgtatttttgtccattttgatgcagcagaaggtaatcaaatc
ccggcaataccagaccggttagcttttgcagaattatatagtctcattaaaaaattccaa
ccatttccaatcgaaaagtacacaccacggctaatgcaaaaatttggttggaataaagag
caaatagatttcatgtcaaaggtgttttttgatttagaatttgctaaaatggatagtggt
cagattattatcaatgaagttgttgaaaaacgtaatctggacgagtcacttgtttatcaa
caaaaggtagaagaaataactacaagaaaaaaactgttgtactccaattatactgagctt
catagttggatgaaatcaatgatggaaacatcaatttacccgaatgcggaggaactagaa
aatggaaattaa

DBGET integrated database retrieval system