KEGG   Listeria monocytogenes Finland 1998: LMLG_1808Help
Entry
LMLG_1808         CDS       T01986                                 

Definition
(GenBank) D-tyrosyl-tRNA(Tyr) deacylase
  KO
K07560  D-aminoacyl-tRNA deacylase [EC:3.1.1.96]
Organism
lms  Listeria monocytogenes Finland 1998
Brite
KEGG Orthology (KO) [BR:lms00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lms03016]
    LMLG_1808
Enzymes [BR:lms01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.96  D-aminoacyl-tRNA deacylase
     LMLG_1808
Transfer RNA biogenesis [BR:lms03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Trans-editing factors
    LMLG_1808
 Prokaryotic Type
    LMLG_1808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tyr_Deacylase
Motif
Other DBs
NCBI-ProteinID: AEO39051
LinkDB All DBs
Position
complement(1535805..1536257)
Genome map
AA seq 150 aa AA seqDB search
MRVLLQRCYEASVSMEDEVISEIAGGLCLLVGFTHTDTPETVDYMAKKIVGLRIFEDESE
KMNISLAERGGAILSVSQFTLYADVSRGKRPSFTKSAPGEKAEALYDLFNQKLAEAGFIV
ETGVFGAMMDVKIVNHGPVTIMLDSEEMRK
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtactactacaacggtgttatgaagcgtccgtaagtatggaggatgaagttatt
agtgaaatagctggagggctttgtctattagttggattcactcatacagatacccccgaa
actgtggactatatggcaaaaaaaatcgtgggattacgaatctttgaagatgaatcagag
aagatgaatatttctttagccgaacgaggtggcgcgattcttagcgtttctcagttcact
ttatacgctgatgtaagtagagggaaacgtccaagctttacaaaatccgctcctggagaa
aaagcagaagcactgtatgatttatttaatcaaaaacttgcagaagcgggttttattgtt
gaaactggagtatttggcgctatgatggatgtgaaaattgtcaatcacggtccagtaaca
ataatgctcgattcagaggaaatgcgtaaataa

DBGET integrated database retrieval system