KEGG   Listeria monocytogenes Finland 1998: LMLG_1843Help
Entry
LMLG_1843         CDS       T01986                                 

Definition
(GenBank) phosphate ABC transporter, ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
lms  Listeria monocytogenes Finland 1998
Pathway
lms02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:lms00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    LMLG_1843
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lms02000]
    LMLG_1843
Enzymes [BR:lms01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     LMLG_1843
Transporters [BR:lms02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    LMLG_1843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N RsgA_GTPase AAA_15 Rad17 AAA_22 AAA_29 AAA_16 Adeno_IVa2 AAA_30 G-alpha AAA_25 AAA_23 AAA_18 AAA_24 AAA_33 IstB_IS21 RNA_helicase AAA_28 TsaE PRK MMR_HSR1 AAA_14 NACHT ATPase_2 NB-ARC Viral_helicase1 AAA_5
Motif
Other DBs
NCBI-ProteinID: AEO39960
LinkDB All DBs
Position
complement(2508532..2509311)
Genome map
AA seq 259 aa AA seqDB search
MTTETAEKVEYIIETKDVDLFYGSKQALQKIALNIKKNQVTALIGPSGCGKSTFLRTLNR
MNDLIPNVKTTGEIHIGGENVQDPKIDMVNLRKKVGMVFQQANPFPFSIYDNVAYGPRMH
GIKDKKVLDEIVERSLRQAALWEEVHDRLDRSAIGMSGGQQQRLCIARVLAVKPDVILMD
EPTSALDPISTAKVEDLILELKKDYTIVIVTHNMQQASRISDETAFFLNGRIVEFADTTS
IFTNPAEKETEDYISGRFG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccgaaactgctgaaaaagtagagtatatcattgaaacaaaagatgtagattta
ttttatggttccaaacaagcactacaaaaaatcgctttaaatattaagaagaatcaagtg
accgccttaattggtccatcggggtgtgggaaatctactttcctgcgaacgcttaaccga
atgaacgatttaattcccaatgtgaaaacgaccggagaaatccatattggcggcgaaaat
gtgcaagatcctaaaattgacatggttaacttacgaaaaaaagtgggtatggttttccaa
caagcgaacccgttcccgttttcgatttatgataatgttgcttatggtccgcggatgcat
ggtataaaagacaaaaaagtacttgatgagattgtagaaagaagtttgcgtcaagcggct
ctttgggaagaagtgcatgataggctggatcgttcggcgattgggatgtcaggtggacaa
cagcagcgactttgcatcgcacgagttctagctgttaagccggatgttatcttgatggat
gagccaacttcggcactagacccaatttcgacagcaaaagtagaagatttaattttagaa
ttaaagaaagactatacgattgtcattgtgacgcataatatgcaacaagcatcccggatt
tccgatgaaactgcctttttcttaaacggtcgcatcgtggagttcgcggatacgacgagt
atttttaccaacccagcagaaaaggaaacagaagattatatttcaggaagatttggataa

DBGET integrated database retrieval system