KEGG   Listeria monocytogenes 10403S (serotype 1/2a): LMRG_00743Help
Entry
LMRG_00743        CDS       T01984                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
lmt  Listeria monocytogenes 10403S (serotype 1/2a)
Pathway
lmt00564  Glycerophospholipid metabolism
lmt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    LMRG_00743
Enzymes [BR:lmt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     LMRG_00743
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 NAD_binding_8 Pyr_redox_2 FAD_oxidored FAD_binding_3 Pyr_redox 3HCDH_N Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AEO06278
UniProt: A0A0H3GBR3
LinkDB All DBs
Position
1279522..1281198
Genome map
AA seq 558 aa AA seqDB search
MVQLFSAFDRETIERNLQEEKFDLVIVGGGITGAGIALDATSRGMSVALVEMGDFASGTS
SRSTKLVHGGLRYLQQFEIKEVADLGKERAIVYENGPHVTTPEWMMLPFHKGGNMGKTTA
SFGIRLYDYLAGVKKNERRKILSAKETLAKNPFVKKDGLKGSGYYVEYRTDDARLTIEVM
KKAVELGANAINYTKAEHFLYDDNKQVVGVTVTDRLSGKAYDIKGHRVINAAGPWVDKVR
KLDYATNNKHLRLTKGIHLVIDKQKFPMEQAVYFDTPDGRMVFAIPRDKKVYVGTTDTVY
DEAVINPKALESDHNYVIKAINYMFPDVHITEKDIESSWAGVRPLIYEEGKDPSEISRKD
EVWFSESGLITMAGGKLTGYRKMAEKLLDDVSKTLAKETGKKYKTVQTKHLPISGGDIGG
SEQLEAFLSKKAKEGNNRFGWTLEEGREMAKRFGSNIDQLFTYAQEHKEQNETTLPNSLY
AELRYSIQHEAVTTPIDFLLRRTGYLLFDMPYLLEWKDAVVDEMAKQFHWSDDVKQTYIE
ELNIQINDAREPADWHDR
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggtacaattattttcagcgtttgacagagaaacaatcgaaagaaatcttcaagaggaa
aaatttgatttagtcatcgtcggtggaggaattacaggagcgggaatcgctttagatgct
acttcacgaggcatgagtgtcgcgcttgttgaaatgggtgatttcgcgagcggaacatcg
agccgttcaacgaaattagtccacggtggattaagatatttacaacaatttgaaattaaa
gaagtagcagatttaggaaaagaacgtgcgatagtctacgaaaatggaccacacgtaacg
actcctgaatggatgatgctcccgttccataaaggtggcaatatgggcaaaactaccgct
tcgtttggtattcgtttatatgactatttagcaggtgtaaagaaaaatgaacgacgtaaa
attctaagcgcaaaagaaacactagcaaaaaatcctttcgtgaaaaaagacggcttaaaa
ggatctggttactacgtagaataccgcactgatgatgcgcgtttaacaatagaagtaatg
aaaaaagcggtagaacttggagcgaatgccattaactatacaaaagcagagcatttctta
tatgatgacaataaacaagtagttggcgtaaccgtaacagatcgtttgtcgggcaaagca
tacgatattaaaggacatcgagttattaatgctgctggtccatgggtagataaagtaaga
aaattagattacgcaacaaacaacaaacatttacgcttaacaaaaggaattcatttggtt
atagataaacaaaaattcccgatggaacaagctgtatactttgatacacctgatggccgg
atggtttttgctattccacgcgataaaaaagtatatgttggaacgacggatactgtatac
gacgaagcagtaatcaatccaaaagctcttgaatctgatcataattatgtgattaaggcg
attaactatatgttccctgatgtgcatattaccgaaaaagatattgaatcaagttgggct
ggggttcgtccacttatctatgaagaaggtaaagatccatctgaaatttcacgtaaagat
gaagtttggttttctgaaagcggcttaattacgatggcaggcggtaaactcactggttac
agaaaaatggccgaaaaattattagatgacgtttctaaaacattagcgaaagaaactggt
aaaaagtataaaacagttcaaacaaaacatttaccaatttctggtggtgacattggtggt
tcagaacaattagaagctttcctatctaaaaaagcgaaagaaggtaataatcgtttcggc
tggactttagaagaaggccgtgagatggctaaacgttttggtagtaatatcgatcaatta
tttacttatgcacaggaacataaagaacaaaacgaaaccactttaccaaacagtttgtac
gctgaactacgctactcaattcaacatgaagcagtgacaacaccaatcgatttcttatta
cgtcgcactggctacttgcttttcgatatgccgtacttacttgaatggaaagacgctgtt
gtggatgaaatggctaaacaattccactggagcgacgatgtaaaacaaacctatattgag
gaattaaatattcaaattaatgatgctagagaaccagctgattggcacgatagataa

DBGET integrated database retrieval system