KEGG   Listeria monocytogenes 10403S (serotype 1/2a): LMRG_01035Help
Entry
LMRG_01035        CDS       T01984                                 

Definition
(GenBank) cell cycle protein gpsB
Organism
lmt  Listeria monocytogenes 10403S (serotype 1/2a)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DivIVA DUF5595 DUF4164
Motif
Other DBs
NCBI-ProteinID: AEO06870
UniProt: A0A0H3GLE6
LinkDB All DBs
Structure
PDB: 

Position
complement(1918736..1919077)
Genome map
AA seq 113 aa AA seqDB search
MTSEQFEYHLTGKEILEKEFKTGLRGYSPEDVDEFLDMVIKDYSTFTQEIEALQAENIRL
VQELDNAPLRTSTQPAPTFQAAAQPAGTTNFDILKRLSNLEKHVFGNKLDDNE
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgacttcggaacaatttgagtatcacttaacaggcaaagaaattttggaaaaagaattt
aaaactgggcttcgtggttatagtcctgaagatgttgatgagtttttagacatggttatt
aaagattacagtacatttactcaagaaatcgaagcgcttcaagctgaaaatattcgactt
gtacaagagcttgataatgcaccgcttagaacttcaacacaaccagctccaactttccaa
gcagcggcacaacctgctggaacaaccaactttgatattctaaagcgtctttctaattta
gaaaaacatgtttttggaaataagctggacgataacgaatag

DBGET integrated database retrieval system