KEGG   Listeria monocytogenes 10403S (serotype 1/2a): LMRG_02208Help
Entry
LMRG_02208        CDS       T01984                                 

Definition
(GenBank) L-iditol 2-dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
lmt  Listeria monocytogenes 10403S (serotype 1/2a)
Pathway
lmt00040  Pentose and glucuronate interconversions
lmt00051  Fructose and mannose metabolism
lmt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LMRG_02208
   00051 Fructose and mannose metabolism
    LMRG_02208
Enzymes [BR:lmt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     LMRG_02208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 2-Hacid_dh_C FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AEO07645
UniProt: A0A0H3GG42
LinkDB All DBs
Position
complement(2699541..2700572)
Genome map
AA seq 343 aa AA seqDB search
MKAVVKTNPGYDQMELKDVEEPQVYGDKVKIKVAFTGICGSDIHTFKGEYKNPTTPVTLG
HEFSGVVVEVGPDVTSIKVGDRVTSETTFETCGECIYCKEHDYNLCSNRRGIGTQANGSF
AEFVLSREESCHVLDERISLEAAALTEPLACCVHSALEKTTIRPDDTVLVFGPGPIGLLL
AQVVKAQGATVIMAGITKDSDRLRLAKELGMDRIVDTLKEDLAEVVLGMTGGYGAERVFD
CSGAVPAVNQGLPLTKKKGDFVQVGLFAEKKNAIDEESIIQREIAYIGSRSQKPSSWILA
LDLLANGKIDTDKMITKVYGLDDWREAFEAVMAGNEIKVLVKS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagcagtagtaaaaacaaatcccggatatgatcaaatggagctaaaagatgtggaa
gaaccacaagtctatggcgacaaagtaaaaatcaaagtagcattcactggtatttgcgga
tcagatatccatacgtttaaaggagaatacaaaaatccaacaactcccgtcacacttgga
catgaattttctggtgtcgttgtagaagttgggccagatgtaacgagtatcaaagtggga
gaccgtgtcacaagtgaaacaacttttgaaacttgtggagaatgtatttattgtaaggaa
cacgattacaatttatgtagcaatcgtcgcggcattggtacgcaagcaaatggtagtttt
gcagaatttgttttatctcgcgaggaaagttgccacgtgctagatgaacgtatttcgctc
gaagcagcagcactgacagaaccacttgcatgttgcgtgcattcggcgcttgaaaaaaca
acaattcgtccagatgacacagtacttgttttcggaccggggccaattggattattacta
gctcaagttgtgaaagcgcaaggggcaacggtgattatggcaggaattaccaaagatagc
gaccgcttacgtctagcaaaagaacttggaatggaccggattgtcgataccttaaaagaa
gacttggctgaagttgtgctcggcatgacagggggttacggagcggaacgcgtatttgat
tgctcaggcgcagtaccagctgtaaatcaaggattacctctaacgaagaaaaaaggcgat
tttgttcaagtaggactttttgccgaaaagaaaaatgcgattgatgaagaatctattatc
caacgtgaaattgcttatattggcagccgttctcaaaaaccatcttcttggattttagca
ctcgacttacttgctaatggcaaaatcgatacagataaaatgattaccaaagtatatggt
ttagatgactggcgcgaggctttcgaggcagttatggcaggtaatgaaattaaagtatta
gtgaaatcttaa

DBGET integrated database retrieval system