KEGG   Lactobacillus mucosae: LBLM1_00630
Entry
LBLM1_00630       CDS       T03814                                 

Definition
(GenBank) L-2-hydroxyisocaproate dehydrogenase
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Organism
lmu  Lactobacillus mucosae
Pathway
lmu00010  Glycolysis / Gluconeogenesis
lmu00270  Cysteine and methionine metabolism
lmu00620  Pyruvate metabolism
lmu00640  Propanoate metabolism
lmu01100  Metabolic pathways
lmu01110  Biosynthesis of secondary metabolites
lmu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBLM1_00630
   00620 Pyruvate metabolism
    LBLM1_00630
   00640 Propanoate metabolism
    LBLM1_00630
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    LBLM1_00630
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lmu04147]
    LBLM1_00630
Enzymes [BR:lmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     LBLM1_00630
Exosome [BR:lmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   LBLM1_00630
  Exosomal proteins of breast milk
   LBLM1_00630
SSDB
Motif
Pfam: Ldh_1_N Ldh_1_C F420_oxidored NAD_Gly3P_dh_N UDPG_MGDP_dh_N TrkA_N ApbA Semialdhyde_dh NAD_binding_7 3HCDH_N NAD_binding_2 Shikimate_DH Glyco_hydro_4 Sacchrp_dh_NADP ThiF
Other DBs
NCBI-ProteinID: AJT49755
UniProt: A0A0D4CIL9
LinkDB
Position
131837..132781
AA seq 314 aa
MTRKVGVIGSGNVGSTLANNMLVAGTADTLVLIDTNELKLNSDATDFEDAAANLPTHTTV
VRNDYEALADADVVVIAVGSIGVQNDDAKHDRFVELKVTSKAAKEVGTKLKEVGFHGVLV
SISNPCDVIAALFQKYTGLPKTQVIGTGTLLDTSRMKKVVGQKFDVDPRSVSGYNLGEHG
NSQFSAWSQVRVMGHPVTELAKDRDDVDLDQLAEDVRAGGYVVFHGKKHTNFGIAAAALR
LVTAVLNDAHTELPVSNFREEYGTYVGYPAIIGRQGLVRQLQLDLTNEEKDKLAASAKYI
KDRFDDVAAKLDNE
NT seq 945 nt   +upstreamnt  +downstreamnt
atgacgcgaaaagttggtgttattggttcagggaatgttggttcaacgctggctaacaat
atgctggtagcagggacggcggatacgctggtattgattgataccaacgaactaaagctg
aattcggatgcaaccgattttgaggacgcggcggccaatctgccaactcataccacagtg
gtgcgcaacgactatgaagccttggccgatgcagatgtcgtcgtgatcgcggtcggcagt
atcggcgtacagaacgacgatgccaagcatgatcgatttgttgaattaaaggttaccagc
aaggccgctaaagaagtcggtactaaactaaaagaagtcgggttccatggcgtgctggtc
tcaatcagtaatccttgtgacgtgattgccgcgctgttccaaaagtacactggtctgcca
aagactcaggtaatcggtacggggacgctgcttgatacttcacgtatgaaaaaagtcgtt
ggtcaaaagtttgacgttgatccgcgctcggtatctggctacaacctgggtgaacacggc
aactcgcaattctctgcttggtcacaggtacgggtcatgggccatcccgtaaccgaattg
gctaaggatcgtgacgatgttgatctggatcaattggccgaagacgtgcgggcaggtggc
tatgtcgtcttccatggcaagaagcatactaactttgggattgcggcagcggctctgcgt
ctggttacggccgttttgaatgacgcgcacactgagctgccagtttccaacttccgcgaa
gaatacggcacctatgtcggctaccctgccatcattggtcgtcaaggactggttcgtcag
ctgcagcttgatctgactaatgaagaaaaagacaagctggctgcttcggctaaatatatc
aaggatcgctttgatgatgtggctgccaagctggacaacgaataa

KEGG   Lactobacillus mucosae: LBLM1_01165
Entry
LBLM1_01165       CDS       T03814                                 

Definition
(GenBank) lactate dehydrogenase
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Organism
lmu  Lactobacillus mucosae
Pathway
lmu00010  Glycolysis / Gluconeogenesis
lmu00270  Cysteine and methionine metabolism
lmu00620  Pyruvate metabolism
lmu00640  Propanoate metabolism
lmu01100  Metabolic pathways
lmu01110  Biosynthesis of secondary metabolites
lmu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBLM1_01165
   00620 Pyruvate metabolism
    LBLM1_01165
   00640 Propanoate metabolism
    LBLM1_01165
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    LBLM1_01165
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lmu04147]
    LBLM1_01165
Enzymes [BR:lmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     LBLM1_01165
Exosome [BR:lmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   LBLM1_01165
  Exosomal proteins of breast milk
   LBLM1_01165
SSDB
Motif
Pfam: Ldh_1_N Ldh_1_C Sacchrp_dh_NADP Epimerase F420_oxidored Shikimate_DH
Other DBs
NCBI-ProteinID: AJT49844
UniProt: A0A0D4CIF6
LinkDB
Position
245652..246572
AA seq 306 aa
MSKVMLVGDGAVGSAFANDLLQHVSLDELIIVDRKTQKAAGDAMDLEDLAMFDGTTVVRA
GKYEDAADTDVVVITAGIPRKPGESRLDLVNKNVGILKTIIDPIVNSGFKGIFVVASNPV
DILTTLTQRISGFPKNRVIGTGTSLDTARLRVALAKRCHVPVREISVDVLGEHGDTSFAN
FDEATIAGKPLKEFVDVSDEELAEMQSGVKKKGGTIIRSKGATYYGVARCLSLICEAIIF
NRSIVLPLSAPLNGQYGIKDLYLGTPASVNRTGIRYVIETPLSEREVAAMQHSAAKMKEV
LDGVEL
NT seq 921 nt   +upstreamnt  +downstreamnt
atgtcaaaagttatgctggttggcgacggtgcggttggttccgcttttgccaacgattta
ctgcaacacgttagtttagatgaattgatcattgttgatcgtaaaacgcaaaaggcggct
ggcgatgcaatggatctggaagacctggccatgttcgatggaacgacggtggttcgcgct
ggtaagtatgaagacgcagccgataccgatgttgttgtcatcacggcgggaattccgcgc
aagcctggcgagagtcgtttagatctggtcaacaaaaacgttggcattttaaagacgatc
atcgacccaatcgttaacagcggctttaagggaatctttgtcgttgcttccaacccagtt
gatattttgacgacgctgacgcagcggatctctggttttccaaagaaccgggttatcggt
acggggacctcgcttgatacggccagactgcgagttgcgcttgccaaacgctgccatgtg
cccgtacgcgaaatcagtgttgacgttttaggcgagcatggtgatacgtcatttgccaac
tttgatgaagcaacgattgccggcaagcctttaaaagaatttgttgatgtcagtgatgaa
gagcttgcagaaatgcagtctggggtcaaaaaaaagggtggcacgattattcgttccaaa
ggtgcaacctattatggcgttgcccgctgtctttctttgatctgcgaggccatcatcttc
aatcgttcaatcgttttgccattatcggcgcctttgaatggtcagtatggcatcaaggat
ctgtacttagggacgccggcttccgttaaccggactggaattcgttatgtcattgaaacg
ccgctttctgaacgcgaggtggcggcaatgcagcactccgccgccaaaatgaaagaagtt
ttggatggcgttgagctttag

KEGG   Lactobacillus mucosae: LBLM1_02015
Entry
LBLM1_02015       CDS       T03814                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Organism
lmu  Lactobacillus mucosae
Pathway
lmu00010  Glycolysis / Gluconeogenesis
lmu00270  Cysteine and methionine metabolism
lmu00620  Pyruvate metabolism
lmu00640  Propanoate metabolism
lmu01100  Metabolic pathways
lmu01110  Biosynthesis of secondary metabolites
lmu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBLM1_02015
   00620 Pyruvate metabolism
    LBLM1_02015
   00640 Propanoate metabolism
    LBLM1_02015
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    LBLM1_02015
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lmu04147]
    LBLM1_02015
Enzymes [BR:lmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     LBLM1_02015
Exosome [BR:lmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   LBLM1_02015
  Exosomal proteins of breast milk
   LBLM1_02015
SSDB
Motif
Pfam: Ldh_1_N Ldh_1_C TrkA_N F420_oxidored Sacchrp_dh_NADP UDPG_MGDP_dh_N PglD_N NAD_binding_10
Other DBs
NCBI-ProteinID: AJT49980
UniProt: A0A0D4CJ82
LinkDB
Position
398560..399486
AA seq 308 aa
MRKLGIIGLGNVGALLANLLVARQIVDELVLIDTNSDLAVGLQNDLLDGMSALAVQPTIK
VQDYAALKDADAVVLAIGNAELLKEQRFAELTDVGKMMRQIAPQIKQSGFSGVLLNLANP
NEAATAYLQYLTELPRPKVIGLGTVLDTARLHRAIADQVHVAPSAVTGFVYGQHDGEAVP
IWSTFRINGQPLEKPVMGQKIDPHQSEIQAKLNGWYAIKGQGQDVSGMALWTMRILQAVL
SDEQVSFPVALYQPQYQSYLSFAAQLGRQGVGNYTLLPLRPLEEDQLKVAAQNIQDQLNI
LLELPTED
NT seq 927 nt   +upstreamnt  +downstreamnt
ttgcgtaagcttggaattattggacttggcaatgttggcgcgctgctggccaatttgctg
gtggcacggcagattgttgatgagctggttttgattgacaccaacagtgatctggcagtc
ggattgcaaaatgatctgcttgatggtatgtcggcactggcagttcagccaacgattaaa
gtacaggattacgcggcgctcaaggatgcagatgccgttgtcttggcaattggtaatgcg
gaattgttaaaagagcaacgatttgccgaattgaccgatgtcgggaagatgatgcgccag
attgcaccgcagatcaagcagagcggctttagcggggtactgctcaacctggctaatccc
aacgaggcagccacggcctatctgcaatatttaacggaactgccgcggccaaaagtaatc
gggctgggaacggttctggataccgcgcgcctgcatcgagcaattgccgatcaggtccat
gtcgcgcccagtgcggtgactggctttgtctatggtcagcatgatggtgaggccgtgcca
atttggtcaacgtttcgcatcaatggccaaccattggaaaagccggtaatggggcaaaaa
atcgacccacaccaaagcgagattcaggctaaactgaatggctggtatgcaatcaaaggt
caaggccaagacgtcagtgggatggcattatggacgatgcggattttgcaggcagtcttg
tcagatgaacaggtcagttttcccgtggcgctttatcagccgcagtatcaaagttatctg
agttttgccgcgcagcttggtcgacagggcgttggcaactatacgcttttgccattacga
ccattggaggaagatcagctcaaagtcgcggcccaaaacattcaagatcagttaaacatc
ttgctggaactgccaactgaggactag

KEGG   Lactobacillus mucosae: LBLM1_05085
Entry
LBLM1_05085       CDS       T03814                                 

Definition
(GenBank) lactate dehydrogenase
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Organism
lmu  Lactobacillus mucosae
Pathway
lmu00010  Glycolysis / Gluconeogenesis
lmu00270  Cysteine and methionine metabolism
lmu00620  Pyruvate metabolism
lmu00640  Propanoate metabolism
lmu01100  Metabolic pathways
lmu01110  Biosynthesis of secondary metabolites
lmu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBLM1_05085
   00620 Pyruvate metabolism
    LBLM1_05085
   00640 Propanoate metabolism
    LBLM1_05085
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    LBLM1_05085
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lmu04147]
    LBLM1_05085
Enzymes [BR:lmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     LBLM1_05085
Exosome [BR:lmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   LBLM1_05085
  Exosomal proteins of breast milk
   LBLM1_05085
SSDB
Motif
Pfam: Ldh_1_N Ldh_1_C Shikimate_DH NAD_binding_7
Other DBs
NCBI-ProteinID: AJT50479
UniProt: A0A0D4CK77
LinkDB
Position
1096065..1097051
AA seq 328 aa
MSYRQQKVVLIGDGAVGSAYAFAMVQQGLAEEFAIINHTKSKGEGDTLDLEDATVFTSPK
KVESADYSICRDADLVVICAGAAQKPGETRLQLINKNLKIMADVTQNVVKSGFNGIFLVA
ANPVDILTYAVQKISGFPTSRVISSGTLLDTARLRVALAKEFNVSPADVSANVLGEHGDS
EFAAYSSASIGGKNLLKIAEEQNISIERLLEIENETRHKAYEIINRKGATYYGVATALMR
ITKAILRNENAVLPVGAYVNGEYGVHDLYLGTPAVINAHGVEQVIDVQLNEREQKAMAHS
AAVLREAVDRGMNETGLNKEIVSLVADA
NT seq 987 nt   +upstreamnt  +downstreamnt
atgtcttatcgacaacaaaaagtcgtgctgattggtgatggcgcagtcggctctgcctac
gcgtttgccatggttcaacaaggactggctgaagagtttgccattatcaaccacaccaag
agcaagggtgagggtgacacgcttgaccttgaggatgccacggtctttacatcgccaaaa
aaggttgagtcagcggactattccatctgtcgtgatgccgatctggtcgtaatctgtgcc
ggagcagcccaaaagccgggtgagacgcggctgcagctgatcaacaagaacctcaagatc
atggctgatgttacgcaaaacgtggttaagtccggctttaacggcatctttttagtagct
gccaacccagtcgacattctgacctatgccgtccaaaagatctcaggattcccaaccagt
cgggttatcagctccggtacgctgctggacacggcacggctgcgggtagcattggctaag
gaatttaacgtcagcccagctgatgtatccgccaatgttttgggcgaacatggtgattct
gaatttgcggcctattcttcagcctcaatcggtggcaagaatctgcttaagattgccgaa
gagcaaaatatctctattgagcggctattggaaatcgaaaatgaaactcgtcacaaagcc
tacgaaattatcaatcgcaaaggtgcaacctactatggcgttgccaccgctttgatgcgg
attaccaaagctatcttgcgcaatgaaaatgcggtcttaccagttggtgcctatgtcaat
ggcgaatatggcgtccatgatctttacctgggtacgccagccgtaatcaatgcgcatggg
gttgaacaggtgattgacgtccaattgaatgaacgtgagcaaaaagcaatggctcattct
gctgcagtcctgcgtgaagctgtcgatcgcggcatgaacgaaaccggtctgaacaaggag
atcgtctcgttggtagctgatgcataa

KEGG   Lactobacillus mucosae: LBLM1_09210
Entry
LBLM1_09210       CDS       T03814                                 

Definition
(GenBank) L-2-hydroxyisocaproate dehydrogenase
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Organism
lmu  Lactobacillus mucosae
Pathway
lmu00010  Glycolysis / Gluconeogenesis
lmu00270  Cysteine and methionine metabolism
lmu00620  Pyruvate metabolism
lmu00640  Propanoate metabolism
lmu01100  Metabolic pathways
lmu01110  Biosynthesis of secondary metabolites
lmu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBLM1_09210
   00620 Pyruvate metabolism
    LBLM1_09210
   00640 Propanoate metabolism
    LBLM1_09210
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    LBLM1_09210
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lmu04147]
    LBLM1_09210
Enzymes [BR:lmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     LBLM1_09210
Exosome [BR:lmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   LBLM1_09210
  Exosomal proteins of breast milk
   LBLM1_09210
SSDB
Motif
Pfam: Ldh_1_N Ldh_1_C Sacchrp_dh_NADP TrkA_N F420_oxidored UDPG_MGDP_dh_N 2-Hacid_dh_C PglD_N Shikimate_DH ThiF Semialdhyde_dh NAD_Gly3P_dh_N 3HCDH_N NAD_binding_7 ApbA NuDC
Other DBs
NCBI-ProteinID: AJT51119
UniProt: A0A0D4CM41
LinkDB
Position
1968962..1969903
AA seq 313 aa
MSRKVAVIGMGNVGAAVAHYIVACGFVDDLVLIDKNEAKVKADALDFYDAMPNLKNHTNI
FVNDYSQLKDADVVVSALGNIKLQDNKDDDRFAELPFTRVQVREVAQKIKESGFHGKMVV
ITNPVDVITSIYQEVTGLPKNHVIGTGTLLDSARMKRAVAQRLHLDPRSVTGYNLGEHGN
SQFTAWSTVRVLDQPITELAKDRGLDLDSLDHEARVGGFTVFRGKKYTNYGVATAAVRLV
NTILSDAHTELPVSNYREEYGTYLSYPAVVGRDGILEQVQLDLTDEELEKLQTSANYIKQ
KYAESQEAAKEGK
NT seq 942 nt   +upstreamnt  +downstreamnt
atgagtcgaaaagttgctgttatcggaatgggaaacgttggtgccgcagttgctcattat
attgtggcctgtggctttgttgacgacctggtactgattgacaaaaacgaagctaaagtc
aaagccgacgcattggacttctacgacgcaatgccaaacctgaagaaccacaccaacatc
ttcgttaacgactattcgcaattgaaagatgccgatgttgtggtttcagcactcggcaat
atcaagctgcaggacaacaaagacgatgaccgctttgccgaactgccatttacgcgcgtt
caagtccgtgaagtcgctcaaaagattaaagaatccggcttccatggcaagatggtcgta
attaccaatccagttgacgtgattacttcaatttatcaagaagttaccggcctgccaaag
aatcatgtcatcggtacgggaacgctgcttgactcggcacgaatgaagcgggccgttgct
cagcgtctgcatctggatcctcgttccgtgaccggctacaacctgggtgaacatgggaac
tctcaatttactgcctggtcaacggttcgcgtattggatcagccaatcactgaactggct
aaggatcgcggcttggacctggatagtctggatcatgaggcccgagttggcggctttacc
gttttccgtggcaagaagtacaccaactacggggttgcaacggctgccgttcgtctggtc
aacacgattctttctgatgcccacaccgaactgccagtatccaactatcgtgaggaatac
gggacttatctttcctaccctgccgtagttggccgcgatggtattttagaacaggttcaa
ctggatctgactgacgaagagctggaaaaactgcagacatcagccaactacatcaagcaa
aagtacgctgaaagtcaagaagctgccaaggaaggcaagtaa

DBGET integrated database retrieval system