KEGG   Lactobacillus mucosae: LBLM1_00730
Entry
LBLM1_00730       CDS       T03814                                 

Definition
(GenBank) diacetyl reductase
  KO
K03366  meso-butanediol dehydrogenase / (S,S)-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.- 1.1.1.76 1.1.1.304]
Organism
lmu  Lactobacillus mucosae
Pathway
lmu00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:lmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LBLM1_00730
Enzymes [BR:lmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.76  (S,S)-butanediol dehydrogenase
     LBLM1_00730
    1.1.1.304  diacetyl reductase [(S)-acetoin forming]
     LBLM1_00730
    1.1.1.-  
     LBLM1_00730
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase 3HCDH_N NAD_binding_10 Shikimate_DH TrkA_N
Other DBs
NCBI-ProteinID: AJT49772
UniProt: A0A0D4CHZ0
LinkDB
Position
154206..155000
AA seq 264 aa
MTEEKRVAVVTGGDRGIGRGITNQLLKDGYYVVIANRNEEAGKKAVEELNAQGYEGKVVS
VSGDASKKESHERFVKTAVDNFGRLDTYVNNAGIAQIKLLKDETEADMDEIFHVNVYSVL
FGMQAAAAQFRKQDDGDKIRKIINASSIAGHIAFDMLGAYSASKFAIRGLTQAAAKELGR
EHITVNAYCPGIVGTDMWDYIDEKMVEAWGGNKGDYLKKYSGSITLGRVETPADVANYVS
WLASTKSDYMTGQAVQIDGGIQFI
NT seq 795 nt   +upstreamnt  +downstreamnt
atgactgaagaaaagcgcgttgctgtcgttactggtggggaccgtgggattggccgcggc
attacgaaccagctgcttaaggatggctactatgtcgtaatcgccaaccgtaatgaagaa
gccggtaagaaagccgttgaagaactgaacgctcaaggatatgaaggcaaggtcgtatcc
gtatccggcgatgcatccaagaaagaaagtcacgaacgcttcgttaagactgccgttgac
aacttcggccgtctggacacgtacgtaaacaacgctggaattgctcagatcaagctgctc
aaggatgaaactgaagctgacatggatgagattttccatgtcaacgtctactcagtactg
tttgggatgcaggccgccgctgctcaattccgcaagcaggacgatggcgacaagatccgc
aagattatcaacgcctccagtatcgccggtcacattgcctttgacatgctgggtgcctac
tctgcatccaagtttgccattcgtggtttgacgcaggccgccgccaaggaacttggccgt
gagcacattacggtcaacgcctactgcccaggtatcgttggcactgacatgtgggactac
atcgatgaaaagatggttgaagcatggggtggtaacaagggcgactaccttaagaagtac
tctggctccattacgctgggacgggttgaaacgcctgctgacgtggccaattacgtatcc
tggctggcatcgaccaagtccgactacatgactggtcaagccgttcaaatcgatggcggg
attcaatttatctaa

DBGET integrated database retrieval system