KEGG   Lactobacillus mucosae: LBLM1_00795
Entry
LBLM1_00795       CDS       T03814                                 

Definition
(GenBank) aldose epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
lmu  Lactobacillus mucosae
Pathway
lmu00010  Glycolysis / Gluconeogenesis
lmu00052  Galactose metabolism
lmu01100  Metabolic pathways
lmu01110  Biosynthesis of secondary metabolites
lmu01120  Microbial metabolism in diverse environments
Module
lmu_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:lmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBLM1_00795
   00052 Galactose metabolism
    LBLM1_00795
Enzymes [BR:lmu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     LBLM1_00795
SSDB
Motif
Pfam: Aldose_epim SSURE Alpha_kinase
Other DBs
NCBI-ProteinID: AJT49785
UniProt: A0A0D4CIP3
LinkDB
Position
complement(165119..166162)
AA seq 347 aa
MEIKESSFGTFEGQEVKKYTLINDQDMQVSVLNYAGLLQEISVPGKDGKRVNLVLSAADI
EHFTDNGMCNNRVIGRVAGRLAKGEFAIDGQEYHVDTNENGNTLHGGPNGLGNQFFEAET
VTTPNTVKVVLTKTMTPEIDSFPGNEKVTVTYSLSNDNRVVIDLDGKTDANTLFNPTVHT
YFNLGDSDVATVEDQVLQVNSKFHLDVDDEKIPTGKKLVNAGTPFDFQTPRRLGDALNEM
KSTKEGGFDDIWQVEPSTNVNHEPVATLSDPASGRKMKLYSDRNGLVMYTANGMDKSLQF
NRPSASWCALAMEAQTLSDTPHHPEFGDITLRPGKPAHHRIVYAIEF
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggaaattaaagaaagcagtttcggtacttttgaaggacaagaagtcaaaaaatacacg
cttatcaacgatcaggacatgcaggtcagcgttttaaactatgccggtctgttacaggaa
atctcggttccaggcaaagacggcaagcgcgtcaacctggttttaagcgcagccgacatt
gagcactttactgacaacggcatgtgcaacaaccgagtaatcggccgtgttgccggacgg
ctggccaagggcgagtttgcgatcgatggtcaggagtatcacgtcgacactaatgaaaac
ggcaatacgcttcatggtggcccgaatggtttaggcaaccagttctttgaagccgaaact
gttacgacgccaaataccgttaaagttgtcttaaccaagaccatgacgcctgaaatcgac
tctttcccaggcaatgagaaagttacggttacctactcactgagcaatgacaaccgtgtc
gtaatcgatctggatggcaaaacggatgccaacacgctgttcaacccaaccgttcacacc
tacttcaaccttggcgattctgacgtggcaaccgttgaagatcaagtattacaggttaac
tccaagttccacttagacgttgacgatgaaaagattccaactggcaaaaagctcgtaaat
gccggcacgccatttgatttccaaactcctcgtcgtttgggcgatgcgcttaatgaaatg
aagagtactaaagaaggcggctttgatgacatctggcaggttgaaccaagcacgaacgtc
aaccacgaaccagttgccacgctgtctgaccctgccagcggccgcaagatgaagctgtac
tcagatcgcaatggtttggtaatgtacactgccaatggaatggacaagtcgctccaattc
aaccggccaagtgcctcatggtgtgcgctggcaatggaagcccaaacgctttctgacacg
cctcaccatccagaattcggcgatatcaccctgcgtcctggcaagccagctcaccaccgc
atcgtttacgcaattgaattttaa

DBGET integrated database retrieval system