KEGG   Lactobacillus mucosae: LBLM1_01155
Entry
LBLM1_01155       CDS       T03814                                 

Definition
(GenBank) fumarate hydratase
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Organism
lmu  Lactobacillus mucosae
Pathway
lmu00020  Citrate cycle (TCA cycle)
lmu00620  Pyruvate metabolism
lmu01100  Metabolic pathways
lmu01110  Biosynthesis of secondary metabolites
lmu01120  Microbial metabolism in diverse environments
lmu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LBLM1_01155
   00620 Pyruvate metabolism
    LBLM1_01155
Enzymes [BR:lmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     LBLM1_01155
SSDB
Motif
Pfam: Lyase_1 FumaraseC_C
Other DBs
NCBI-ProteinID: AJT49842
UniProt: A0A0D4CI54
LinkDB
Position
242651..244048
AA seq 465 aa
MPEFRTEEDTLGPVQIPADALWGPQTERSRHNFPTGQYMPIAIIRALLNIKKAAAQANME
TNAISEEKGSLIVKAVDELLALSDEDLRKDFPLKVYQTGSGTQTNMNTNEVVAHKAMQIN
PEVEILPNDDVNKGQSSNDTFPTAMNVVALEALDKLKPAVQHLIDELKIKQDKYWETVKV
GRTHLQDAVPLTFGQEVSGYVAALEHDLKYIEQLEPTLEELAIGGTAVGTGLNAAEGMPE
KIAEKLSQAYGLKLTAKSNKFYGLSHHSGLNVVHGALKTLAADMFKIAQDIRFLASGPRA
GYGELHIPANEPGSSIMPGKVNPTQAEAVTMAALRVFGNDVVVSTASSQGNFEMNVFKPV
MIDAFLESADLLTGTTMGFADKMIHGLTVNEKRMKELLDNSLMTVTALSPHIGYHDSAKI
AQAADKAGSTLKEAALKSGKVTEEQYDEWMDPLKMTNADRHDYED
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgccagaatttcgtactgaagaagatactctaggtccagttcaaatccctgctgatgct
ttatggggccctcaaactgaacggagccgtcacaacttcccaactggccaatacatgcca
atcgccatcattcgtgcactgctgaacattaaaaaggcagctgcccaagctaacatggaa
accaacgctatttcagaagaaaaaggcagcctgatcgttaaagccgttgacgaactgctg
gccttaagcgatgaagatctgcgcaaggacttcccattgaaggtctaccaaaccggttct
ggtacgcagaccaacatgaacactaatgaagtcgttgctcacaaggctatgcagatcaac
cctgaagtagagatcctgcctaacgatgacgtcaacaagggtcaaagctcaaacgacacg
ttcccaacggcaatgaacgtcgtagccttggaagccttggacaagctgaagccagccgta
cagcacctgattgacgaactaaagatcaagcaggacaagtactgggaaacggttaaggtt
ggccggacccacctgcaggatgccgttccattgacttttggccaagaagtctctggctat
gtggctgcgcttgaacatgacttgaagtacattgaacagctcgaaccaacgctggaagaa
ctggcaattggtggtacggctgttggtacaggcctgaacgccgctgaaggcatgcctgaa
aagatcgctgaaaagctcagccaggcatatggtctgaagctgactgccaagagcaacaag
ttctacggcctgtcgcatcactctggtcttaacgtggttcacggagccttaaagacgctg
gcagctgacatgttcaagattgcccaagacatccggttcctggcttctggtccacgggct
ggctatggcgagctgcacattcctgccaacgaaccaggctcttcaatcatgcccggcaag
gttaacccaactcaagctgaagccgttacgatggctgctctgcgggtctttggcaatgac
gtggtcgtttcaactgcctcctcacaaggcaactttgaaatgaacgtcttcaagccggtt
atgatcgatgccttcttggaatctgccgacctgctgacgggtacgacgatgggctttgcc
gacaagatgattcatggcttgacggttaacgaaaagcggatgaaagaactgctggacaac
tcgctgatgaccgtgacggcactttctccacacatcggctaccatgacagtgccaagatt
gctcaagccgctgacaaggccggcagcacgctgaaggaagccgccttgaagtctggcaag
gttactgaagaacaatatgacgaatggatggatccgctgaagatgaccaacgctgatcgt
catgactacgaagactaa

DBGET integrated database retrieval system