KEGG   Lactobacillus mucosae: LBLM1_01160
Entry
LBLM1_01160       CDS       T03814                                 

Definition
(GenBank) cytochrome C
  KO
K00244  fumarate reductase flavoprotein subunit [EC:1.3.5.4]
Organism
lmu  Lactobacillus mucosae
Pathway
lmu00020  Citrate cycle (TCA cycle)
lmu00190  Oxidative phosphorylation
lmu00620  Pyruvate metabolism
lmu00650  Butanoate metabolism
lmu01100  Metabolic pathways
lmu01110  Biosynthesis of secondary metabolites
lmu01120  Microbial metabolism in diverse environments
lmu01200  Carbon metabolism
lmu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LBLM1_01160
   00620 Pyruvate metabolism
    LBLM1_01160
   00650 Butanoate metabolism
    LBLM1_01160
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    LBLM1_01160
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LBLM1_01160
Enzymes [BR:lmu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.4  fumarate reductase (quinol)
     LBLM1_01160
SSDB
Motif
Pfam: FAD_binding_2 DAO FAD_oxidored Pyr_redox_3 Pyr_redox_2 NAD_binding_8 HI0933_like Thi4 FAD_binding_3 Pyr_redox GIDA Amino_oxidase AlaDh_PNT_C YjeF_N
Other DBs
NCBI-ProteinID: AJT49843
UniProt: A0A0D4CI85
LinkDB
Position
244065..245453
AA seq 462 aa
MAQFQTTPVSQLADSYDAVIVGSGGTGLAAAIQAHELGMNVAVLEKEEQLGGNTNRASSG
MNAAETNVQLKHGIIDNINDFYRETYKDGGKLNDKDMLGYFVVHSPLAIDWLADHGIKLE
DVTITGGMSKKRTHRPASMAPIGGFLVKSLLDVAAQEKIPVFNKVKVEKLVKNDQGAVAG
VVASVDGQTKQINAKAVLLATGGFGASKEYIKRYRPDLADYKTTNQPGATGDGLKLAEEV
GAQLTQMNFVQVHPTVQQDNPHVYLIGEAVRGEGAILVNFQGKRFVNELNTRKIVSETIT
ALPEHSAYLIFDQGVRDHAKAIEFYDKVGLVVHGDTIEDLAKKLKMDPAVLKNTVETWNQ
AVKAGDDKEFGRTTGMDRDLSKPGYFAIHIAPAIHYTMGGIHINTKTQVLDGNGDVIPGL
YAAGEVSGGLHGNNRVGGNSIAETIIFGRQAGQQVTVYAREH
NT seq 1389 nt   +upstreamnt  +downstreamnt
atggcacaatttcaaaccacgccagtcagtcaactggcagacagctatgatgcggtaatc
gttggttctggcggtaccggtctggcagctgcaattcaagcccatgaactgggaatgaac
gtagctgtactggaaaaagaagaacagcttggtggtaataccaaccgagcatcttctggg
atgaacgccgccgagaccaacgttcagctcaagcatggcattattgacaacatcaatgac
ttctaccgtgaaacttacaaagacggtggcaagctcaatgataaggatatgctgggatac
ttcgtcgttcactcgccactggcaatcgactggctggctgatcatggcattaaactggaa
gacgttacgattactggcgggatgtctaaaaagcggacgcaccgaccagcttccatggcg
ccaattggtggattcttggttaagagcctgctggatgtggctgctcaagagaagattccg
gtcttcaacaaggttaaggtcgaaaagctggtcaaaaacgatcaaggcgcagttgccggt
gtagttgccagtgtcgatggccaaaccaagcagatcaatgccaaggccgtcttactggca
actggcggcttcggggcctctaaggaatacattaagcgctatcgtccagatctggccgac
tacaagacgaccaatcaacccggagcaaccggtgatggcttgaagctggctgaagaggtt
ggcgcccagctgacgcagatgaatttcgttcaggttcacccaaccgttcaacaagacaat
ccacatgtctacttgattggtgaagccgttcgtggtgaaggcgcaattctggttaacttc
caaggcaagcgtttcgtcaacgagctgaacacgcgcaagatcgtctcagaaacgattacc
gctctgccagaacacagtgcctatctgatctttgaccaaggcgtgcgtgatcatgccaag
gctatcgagttctacgacaaggttgggctggtcgttcatggcgacacgattgaggatctg
gctaagaaactgaagatggatccagctgtcttgaagaacacggttgaaacttggaaccag
gctgtcaaagctggcgacgacaaggaatttggccgaacgacggggatggatcgcgatctg
tccaagccaggctactttgccattcatatcgcacctgccatccactacacgatgggtgga
attcacatcaataccaagacacaggtacttgatggcaatggcgacgttatccctgggctg
tatgcagctggtgaggtttctggcggcctgcacggcaacaaccgggtcggcggcaactca
atcgctgaaacgatcatctttggtcgtcaagctggtcaacaagtaacggtttacgctcgc
gaacattaa

DBGET integrated database retrieval system