KEGG   Lactobacillus mucosae: LBLM1_01975
Entry
LBLM1_01975       CDS       T03814                                 

Definition
(GenBank) acetoin reductase
  KO
K03366  meso-butanediol dehydrogenase / (S,S)-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.- 1.1.1.76 1.1.1.304]
Organism
lmu  Lactobacillus mucosae
Pathway
lmu00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:lmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LBLM1_01975
Enzymes [BR:lmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.76  (S,S)-butanediol dehydrogenase
     LBLM1_01975
    1.1.1.304  diacetyl reductase [(S)-acetoin forming]
     LBLM1_01975
    1.1.1.-  
     LBLM1_01975
SSDB
Motif
Pfam: adh_short_C2 adh_short KR 3HCDH_N Epimerase F420_oxidored Shikimate_DH Dynein_attach_N
Other DBs
NCBI-ProteinID: AJT49972
UniProt: A0A0D4CII9
LinkDB
Position
390280..391050
AA seq 256 aa
MAKVALVTGAGQGIGKAIAERLAKDGFSVVVVARHMDALQKVVEGIKANGGEAFAVTADV
AKRDEVFAAVDQAVEHYGDFNVMVNNAGVAPTTPIDTVTPEDLQKVYSINVGGTIWGVQA
AHAAFKKLGHPGKIINATSQAGVVGNPNLTVYSSSKFAIRGITQVTARELAEEGTTVNAY
APGIVKTPMMMDIAHQVGKNAGKSDEWGMQTFAKDIALKRLSEPEDVANAVAFLAGPDSD
YITGQTLEVDGGMQFH
NT seq 771 nt   +upstreamnt  +downstreamnt
atggcaaaagttgcattagttaccggtgcaggtcaagggattggtaaggcgatcgctgaa
cgtttggctaaagatggtttttcagtcgtcgttgttgctcgccacatggacgcactgcaa
aaagtagttgaaggcatcaaggcaaatggcggtgaagcttttgccgtcacggccgatgtt
gccaagcgcgatgaagtctttgctgccgttgaccaggctgttgaacactacggcgacttc
aatgttatggttaacaatgccggggttgctccaacgacaccaattgacactgtaacgcct
gaagatctgcaaaaggtttacagcatcaacgttggtggtacgatctggggcgttcaggct
gctcatgccgcatttaagaagcttggccacccaggcaagatcatcaacgctacttcccaa
gccggggtcgttggtaaccctaacctgaccgtatactccagctccaagtttgccattcgt
gggatcacccaggttacggctcgtgaactggctgaagaaggcacgacggttaacgcatac
gcacctgggattgtgaagacgccaatgatgatggacattgctcaccaagtcggcaagaat
gcaggcaagagcgatgaatggggcatgcagacgtttgctaaggacattgcgctgaaacgc
ctgtctgaacctgaggacgttgctaatgccgttgccttcctggctggtccagactctgac
tacattactggtcaaactctggaagtcgatggcgggatgcagttccactaa

DBGET integrated database retrieval system