KEGG   Lactobacillus mucosae: LBLM1_03215
Entry
LBLM1_03215       CDS       T03814                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lmu  Lactobacillus mucosae
Pathway
lmu00010  Glycolysis / Gluconeogenesis
lmu00052  Galactose metabolism
lmu00500  Starch and sucrose metabolism
lmu00520  Amino sugar and nucleotide sugar metabolism
lmu00521  Streptomycin biosynthesis
lmu01100  Metabolic pathways
lmu01110  Biosynthesis of secondary metabolites
lmu01120  Microbial metabolism in diverse environments
lmu01200  Carbon metabolism
Module
lmu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
lmu_M00909  UDP-N-acetyl-D-glucosamine biosynthesis, prokaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:lmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBLM1_03215
   00052 Galactose metabolism
    LBLM1_03215
   00500 Starch and sucrose metabolism
    LBLM1_03215
   00520 Amino sugar and nucleotide sugar metabolism
    LBLM1_03215
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LBLM1_03215
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    LBLM1_03215
Enzymes [BR:lmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LBLM1_03215
SSDB
Motif
Pfam: ROK BcrAD_BadFG IF2_N FGGY_N
Other DBs
NCBI-ProteinID: AJT50175
UniProt: A0A0D4CJT9
LinkDB
Position
637358..638332
AA seq 324 aa
MNKKLIGVDLGGTTIKFAILTDQGEIQQKWSLRTNILDEGSHIVPDIIESINHHIDLYKM
DRSQFIGIGMGTPGTVNREEGTVIGAYNLNWKTLQPVKEQIEKGTGLKFALDNDANCAGL
GERWKGAGHEGDDVVFITLGTGVGGGIIANGKLVHGVNGAGGEVGHIIVEPNGYECTCGN
HGCLEQYASATGIVHLAQDAAEEYEGNSRLKAMIDNGDEITAKIVFDLAKENDFLANEVV
KKVTYYLGLACANISNTLNPETVVIGGGVSAAGEFLLKRVQQNFQKFAFPTVRTSTQLKL
AQLGNDAGVIGAASLALDFIADEK
NT seq 975 nt   +upstreamnt  +downstreamnt
atgaacaagaagttaatcggtgttgaccttggtgggactacgatcaagtttgctattttg
acggatcaaggcgaaatccaacaaaagtggtcgctgcggactaacattttggatgaaggt
tctcacatcgttcccgatattattgaatccatcaaccatcacattgatctgtacaagatg
gaccgcagccagtttatcgggatcggcatggggacgccaggaacggttaaccgcgaagaa
ggaacggtcattggcgcctacaacctgaactggaagacgctgcagccagtcaaggaacaa
atcgaaaaaggtactggcctgaagtttgctctggacaacgatgccaactgtgccggcctg
ggcgaacgttggaagggtgctggccatgagggtgacgatgtggtattcattacgctggga
actggcgtcggcggtgggatcatcgctaacggcaagctggttcatggtgtcaatggtgct
ggtggtgaagttggccacattatcgttgaaccaaacggctatgaatgtacctgcggcaac
cacggctgtctggaacaatacgcttcggctaccgggatagttcacctggctcaggatgct
gctgaagaatacgaaggcaacagccgtttgaaggccatgatcgacaatggcgacgagatt
acggccaagatcgtctttgacctggctaaggaaaacgactttttggcaaacgaagtcgtt
aagaaggttacgtactacctggggctggcatgtgccaacatcagcaacacgctgaaccct
gaaacggtggtgatcggcggtggggtttccgcagctggtgaattcctgcttaagcgcgtt
cagcaaaacttccaaaagttcgccttcccaacggtacggacttccacgcagcttaaactg
gctcagctgggcaacgatgccggcgtgatcggggctgcttcattggcgcttgactttatc
gctgatgaaaaataa

DBGET integrated database retrieval system