KEGG   Lactobacillus mucosae: LBLM1_04105Help
Entry
LBLM1_04105       CDS       T03814                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
lmu  Lactobacillus mucosae
Pathway
lmu00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:lmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LBLM1_04105
Enzymes [BR:lmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     LBLM1_04105
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     LBLM1_04105
    1.1.1.-  
     LBLM1_04105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 Glu_dehyd_C ADH_N_assoc
Motif
Other DBs
NCBI-ProteinID: AJT50311
UniProt: A0A0D4CK95
LinkDB All DBs
Position
complement(848627..849673)
Genome map
AA seq 348 aa AA seqDB search
MKAAVWHGVKDIRVEDVELKPLKSDEVVVKVAWAGICGSDLHEYVEGPVFIPVDKVDELT
GGQAPLTMGHEFSGVVEAVGENVTDVKIGDHVTVNPTVTRERWSDDLNVYDGYSFIGLSC
DGGFTTFVNVPAHNIYHLPSEFPLKLAATIEPTAVAVQAIKEGSLKFGDTTAIFGAGPIG
CLVTAAAKSAGARKIIVCDLSESRLNKAIEMGATDVINSGQVDAVKEIRKLVPNGVDVAF
EVAGVQPTFIQAIHATKPRGTMVVVSIFARPIEFNPMLLTNSGVKVTSTIAYSRQTFKQT
VDLVTQHKIEVAPIITKEIALDDIVEEGFETLINDKKQAKILVELSGE
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcagtttggcatggcgtaaaagacatccgcgtggaagatgttgaattaaag
cctttaaaatcagatgaagtcgttgtaaaagtcgcttgggccggcatttgcggcagcgat
ttgcatgaatatgtcgaaggtccggttttcatcccagtcgataaggtcgatgaactgact
ggcggccaggcaccgctgacgatggggcatgaattttccggggttgttgaggcagtcggc
gaaaacgtcacggatgttaaaatcggtgatcacgttaccgtcaatccaaccgttactcgt
gaacgctggagcgatgatcttaacgtttatgacggctactcctttattggattaagctgt
gatggcggttttaccaccttcgtcaacgtccctgcgcacaacatttatcatttgccaagt
gaatttcctttaaagctggcagccacgattgaaccaaccgccgttgccgtgcaggctatc
aaggaaggctcattgaaattcggcgatacgacggcaatttttggcgctggcccaatcggc
tgtctggttacggcggcggctaagtcagcgggtgctagaaagattatcgtctgcgatctg
tctgagagccgtttaaacaaggcaattgaaatgggcgcaaccgacgtcatcaattctggc
caggtcgacgccgtcaaggagattcgcaagctggtgccaaatggcgttgacgttgccttt
gaagtcgcgggcgtacagcctacgtttattcaggcgattcacgccaccaagccacggggc
acgatggttgtcgtttcaatttttgcccgtcccattgaattcaacccaatgcttttaacc
aacagcggcgttaaagtcacctcaacgatcgcctactcacgccagacgtttaagcagacc
gttgacttggttacgcagcacaagattgaggtcgcccctatcatcaccaaggaaatcgcg
cttgatgatatcgttgaagaaggctttgaaacgctgatcaatgataaaaagcaggccaag
attctggttgagctgagcggtgaataa

DBGET integrated database retrieval system