KEGG   Lactobacillus mucosae: LBLM1_04695
Entry
LBLM1_04695       CDS       T03814                                 

Definition
(GenBank) succinate-semialdehyde dehydrogenase
  KO
K00135  succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
lmu  Lactobacillus mucosae
Pathway
lmu00250  Alanine, aspartate and glutamate metabolism
lmu00310  Lysine degradation
lmu00350  Tyrosine metabolism
lmu00650  Butanoate metabolism
lmu00760  Nicotinate and nicotinamide metabolism
lmu01100  Metabolic pathways
lmu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LBLM1_04695
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LBLM1_04695
   00310 Lysine degradation
    LBLM1_04695
   00350 Tyrosine metabolism
    LBLM1_04695
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    LBLM1_04695
Enzymes [BR:lmu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     LBLM1_04695
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     LBLM1_04695
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     LBLM1_04695
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: AJT50413
UniProt: A0A0D4CJW1
LinkDB
Position
1001086..1002504
AA seq 472 aa
MAYQSIYPYTGELKKTYENQSDEYVEDKLQKADALYHEWRNQPLDGRAEILHAVADNLMK
HQDELAKAMVQDMGKLFGEAKAEVALSAMIANWYADNAKDLLRPQRVYTIMGDAHYEYHS
TGVIMAVEPWNFPYYQVMRVFAPNFMLGNPVMFKQASSVPTTASLLEKYTLEAGAPEGSL
VNLFVTYDQIEKIIADPRVSGVALTGSERAGQKIAAEAGKYLKKSTMELGGSDPFIVLDD
ADLDDIKKILYMARLFNAGQECTSAKRFIVTEKNYDRFLEMLKEEFSKAKMGDPMNPKTT
LAPLSSKSAADDLHQQVKDAIAHGATLAYGNLDAPTPTPNGFWMPAVILTDVTRDNPAYY
QEFFGPVGVVYKVADEEEAIKLANDSHYGLGGQVFAGHSKHAAEVASKIETGAVYCNNFR
GSIPELQFGGVKNSGYGRELGRAGILAFANEQMIMRNPYDKIDLNHTIGGFV
NT seq 1419 nt   +upstreamnt  +downstreamnt
atggcttatcaatcaatctacccatatacgggcgaattgaaaaagacttatgaaaatcag
agtgatgaatacgtggaagacaagctgcaaaaagccgatgctctgtaccacgaatggcgc
aatcaaccactcgacggccgggccgagatccttcacgcagttgcggacaatttgatgaag
catcaagatgaactggcaaaagcaatggttcaagacatgggaaagctttttggcgaggcg
aaagctgaagttgctctgtcagcaatgattgccaactggtatgccgacaatgccaaggat
ctgctgcggccacagcgcgtctacacgatcatgggtgacgcacattacgaataccattcg
acgggggtcatcatggcggttgagccttggaacttcccatattaccaagtcatgcgtgtg
tttgcgcctaactttatgctgggcaacccagttatgttcaagcaggccagttccgttccg
accacggcttcactgctggaaaagtataccttggaggctggcgcaccggaaggatctctg
gttaacctgttcgttacctatgaccagattgaaaaaatcattgccgatccacgagtcagc
ggggttgccttgactggttctgaacgagcgggacaaaagattgctgctgaagccggtaag
tatttgaagaagagcacgatggagctgggcggctcggatccgtttattgttttggatgat
gctgacctggatgacatcaagaaaatcctctacatggcacggctgttcaatgctggccaa
gaatgtacctcagctaagcggtttatcgttacggaaaagaactacgaccggttcctggaa
atgctgaaagaagaattcagcaaggctaagatgggcgacccgatgaaccctaagacaacc
ttggcaccgctaagttctaagagcgcggctgatgatctgcaccagcaggttaaggacgcc
atcgcgcatggggcaacgctggcttatggtaatcttgacgcgccgacgccaacgccaaac
ggtttctggatgccggctgtgatcttaaccgacgttactcgcgataatccggcctactat
caagaattctttggtccagtcggggttgtctacaaggtggcggatgaagaggaagccatc
aagctggccaacgactctcattatggcttgggtggacaagtctttgccggccattccaag
catgcagccgaagtggcatccaagattgagactggtgccgtttactgcaacaacttccgg
ggttcaattcctgaattgcagtttggcggggtcaagaattccggctatggtcgtgaacta
gggcgggctggtattctggcatttgccaatgaacagatgattatgcgcaatccatacgac
aagatcgatcttaaccatacgattggcggttttgtctag

DBGET integrated database retrieval system