KEGG   Lactobacillus mucosae: LBLM1_04945
Entry
LBLM1_04945       CDS       T03814                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
lmu  Lactobacillus mucosae
Pathway
lmu00020  Citrate cycle (TCA cycle)
lmu00480  Glutathione metabolism
lmu01100  Metabolic pathways
lmu01110  Biosynthesis of secondary metabolites
lmu01120  Microbial metabolism in diverse environments
lmu01200  Carbon metabolism
lmu01210  2-Oxocarboxylic acid metabolism
lmu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LBLM1_04945
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LBLM1_04945
Enzymes [BR:lmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     LBLM1_04945
SSDB
Motif
Pfam: Iso_dh PdxA RasGAP
Other DBs
NCBI-ProteinID: AJT51437
UniProt: A0A0D4CMP3
LinkDB
Position
1067685..1068926
AA seq 413 aa
MKNGQLQVPDNPQIPYLQGDGIGPEIWQATQPVLDAAVKRAYQGRRKIDWLPLLAGERAH
ELVDEWLPQQTIMELKRHLVAIKGPMTTPVGTGHRSINVALRQTLDLYACWRPIRYFAGV
PSPVRHPERVCIDLFRENTEDIYAGIEASADSKAAQSLKKWLQETDQLQRVRFPDTAAFG
IKPISKEGSQRLIQSAVDYALKNHRHYLTLVHKGNIMKETEGGFKKWGYQLIEQKYANRV
LPMPRLEKIKKEQGEAVAQQVLQQAQAQGMLIVNDIICDNFFQQALLFPEHFDVVATMNL
NGDYLSDALAAQVGGLGIAPGSNINFQTGCAIFEATHGTAPQLAGKNCANPTSLILSGAM
MMEYLGWGKAAEMIRKAVAQAIAMQKATSDLVPAPAALSTSQYGQLLVELINS
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgaaaaatgggcagctgcaggttcctgacaatccgcaaattccctacctgcagggtgat
ggaattggtccagaaatttggcaggccacgcagccagtgctggatgcagccgttaaacgc
gcctatcaaggacggcgtaagattgactggctgccgcttttagctggcgaacgagcgcat
gagctggttgatgaatggctgccgcagcaaaccattatggaattaaaacggcatctggtt
gcaattaaaggccccatgacgacgccggttggtactggtcatcgctcaatcaacgttgcc
ctgcgacaaacacttgatctgtatgcctgttggcggccaattcgctattttgcaggggtg
ccgtcgccagttaggcatccggagcgcgtttgcatcgatctgtttagagaaaatacggaa
gacatctacgctgggattgaggcatcagctgattccaaggccgctcagtctctaaaaaag
tggctgcaagaaaccgatcagctgcagcgcgtacgttttcccgatacggccgcgtttggc
atcaagccgatctcaaaagaaggctcacagcggctgattcaatcagcagttgactacgcg
ctgaaaaatcatcgtcattatctaaccttggtgcataaaggcaatattatgaaagaaaca
gagggtggctttaaaaaatggggatatcagctgattgagcaaaaatatgccaaccgagtc
ttgccgatgccgcgacttgagaaaataaaaaaagagcagggagaagcggtggcgcaacag
gtcctccaacaagcccaggcacaaggaatgctgatcgtcaatgacatcatctgcgacaat
ttctttcagcaggcattgttatttccagagcactttgatgttgttgccacgatgaacctc
aacggcgactatctatctgatgcattggcggcgcaagtgggcggcttgggaattgcgccg
ggcagcaacattaacttccagactggctgcgcgatttttgaggctacacatggtacggca
ccgcagctagccggaaaaaactgcgccaatccaacgtcgctgatcttatcaggtgccatg
atgatggagtatctgggatgggggaaagcagccgaaatgatcagaaaagcagtcgcgcag
gctattgccatgcagaaggccacatcggatctagtaccggcacctgcagcgctttccacc
agtcagtatggtcagcttttggttgaactcatcaattcttaa

DBGET integrated database retrieval system