KEGG   Lactobacillus mucosae: LBLM1_05090
Entry
LBLM1_05090       CDS       T03814                                 

Definition
(GenBank) pyruvate dehydrogenase
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
lmu  Lactobacillus mucosae
Pathway
lmu00010  Glycolysis / Gluconeogenesis
lmu00020  Citrate cycle (TCA cycle)
lmu00620  Pyruvate metabolism
lmu01100  Metabolic pathways
lmu01110  Biosynthesis of secondary metabolites
lmu01120  Microbial metabolism in diverse environments
lmu01200  Carbon metabolism
Module
lmu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBLM1_05090
   00020 Citrate cycle (TCA cycle)
    LBLM1_05090
   00620 Pyruvate metabolism
    LBLM1_05090
Enzymes [BR:lmu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     LBLM1_05090
SSDB
Motif
Pfam: E1_dh Hema_esterase Pex14_N UPF0182 DXP_synthase_N
Other DBs
NCBI-ProteinID: AJT50480
UniProt: A0A0D4CKN0
LinkDB
Position
1097230..1098321
AA seq 363 aa
MKKLDFEELKHNPEIKPLQVLDEDGKVVNPDLMPDLSDEELVELFKQMIWSRVLGDRTMK
LCRQGRLGFFAPTAGEEASQMGSNFAMSKDDFLLGGYRDVPQLVKHGLPMWKGFLWSKGH
VNGNKYPEELNAVPPQIIIGAQYAQTAGVALGLKKKGAKNVAYTYTGDGGTSQGDFYEGV
NFASAFKAPALFFVQNNLYAISVPRKAQTAAPTLAQKAVASGIPGLQVDGMDALAVYSVA
KQARDWITAGNGPVLIETLCYRYGPHTTAGDVPRRYRSEDEEDIWLKKDPLIRMRKFLES
KGLWDEDQEKSCVEAANKEVDDAMQEVESQPTQTVTELMQNEYVVTPPAIQKELDAYQAK
EAK
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgaaaaagttggattttgaggaattgaagcacaatcccgaaatcaagccgcttcaagtt
ctggacgaggatggcaaagttgtcaatcctgatttgatgcctgacctgagtgacgaagag
ctggttgaactgttcaagcagatgatctggtcacgtgttttgggcgaccgtacgatgaag
ctttgtcgccaaggccgcttaggattctttgctcctactgctggtgaggaagccagtcaa
atgggttccaattttgcaatgagcaaggatgactttctgctgggtggctaccgtgacgtg
ccacaattggttaagcacggtctgccaatgtggaagggattcttgtggagcaagggtcac
gttaacggcaacaagtaccctgaagaattaaatgccgttccgcctcagatcatcatcggc
gcccaatatgctcagacggccggtgtggcacttggcctgaagaagaagggtgccaagaac
gttgcctacacctacactggtgatggtggtacctcacagggtgacttttatgaaggggtc
aactttgccagcgcctttaaagcaccagccttgttctttgtacaaaacaacctgtacgca
atctcggttccaagaaaggctcagacggcagcgccaaccttggctcaaaaggctgttgcc
agcggaattcctggactgcaggttgatgggatggatgccttggctgtctacagcgttgcc
aagcaggctcgtgactggatcacggccggcaatggtcccgtactgatcgaaacgctgtgc
taccgttatggaccgcacacgactgctggtgacgtgccacgccgctaccgttccgaagat
gaagaagatatctggctgaagaaggatccactgattcggatgcgcaagttcttagagagc
aagggcctttgggatgaagaccaagaaaagtcctgtgttgaagcagccaacaaggaagtc
gatgacgcaatgcaggaagttgaatcacagccaacgcagaccgttaccgaactgatgcaa
aacgaatatgtggttacgccgccagcaattcaaaaagagctggatgcttaccaagcaaag
gaggctaagtaa

KEGG   Lactobacillus mucosae: LBLM1_05095
Entry
LBLM1_05095       CDS       T03814                                 

Definition
(GenBank) 2-oxoisovalerate dehydrogenase
  KO
K00162  pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
lmu  Lactobacillus mucosae
Pathway
lmu00010  Glycolysis / Gluconeogenesis
lmu00020  Citrate cycle (TCA cycle)
lmu00620  Pyruvate metabolism
lmu01100  Metabolic pathways
lmu01110  Biosynthesis of secondary metabolites
lmu01120  Microbial metabolism in diverse environments
lmu01200  Carbon metabolism
Module
lmu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBLM1_05095
   00020 Citrate cycle (TCA cycle)
    LBLM1_05095
   00620 Pyruvate metabolism
    LBLM1_05095
Enzymes [BR:lmu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     LBLM1_05095
SSDB
Motif
Pfam: Transketolase_C Transket_pyr PFOR_II
Other DBs
NCBI-ProteinID: AJT50481
UniProt: A0A0D4CKR2
LinkDB
Position
1098324..1099301
AA seq 325 aa
MAKMTMIKAITAAMDEELAHDDKVMIFGEDVGKNGGVFRATDGLQEKYGNDRVFDTPLAE
SGIIGLANGMALEGFRPVPELQFMGFIYEAFDELAGQMARYRFRMGGTRKFPITVRAPFG
GGVHTPELHSDSFEGLLTQVPGLRVVAPSGPYDAKGLLISAIRSDDPVFFCEHMKLYRSI
KEEVPDEAYTVPLDKAAVKREGTDVSIITYGYMVQESLAAADELAKEGINAEVVDLRTLA
PLDEDTILESVKKTGRVVLVQEAQKQAGVGGQVASLIGEKGILYLDAPIARVAAPDTPYP
FSDAEEVWLPNKQDIVDKVKETVNF
NT seq 978 nt   +upstreamnt  +downstreamnt
atggctaagatgacaatgatcaaggcaatcacggctgccatggatgaagagcttgctcat
gatgacaaggtaatgatctttggtgaagacgttggtaaaaacggtggtgtcttccgggca
actgatggcctgcaggagaaatatggcaatgatcgtgtattcgacacgccgctggctgaa
tccggcattatcggactggctaacgggatggcgctggaaggcttccgtcccgtaccagaa
ttgcagtttatgggctttatctacgaagcctttgatgaactggctggtcagatggcgcgc
taccgcttccggatgggcggcacgcgcaagttcccaatcacggtgcgggctccatttggt
ggtggggtgcacacgccagaactgcactcagacagttttgaaggcctgctgactcaggtt
cctgggctgcgcgtggttgcgccaagcggtccttatgacgccaagggacttttgatctcg
gcaatccgctctgatgatccggtcttcttctgtgaacacatgaagctttaccgttcgatc
aaagaagaagtgcctgatgaagcctacaccgttccattggacaaggcagccgtcaagcgc
gaaggcactgacgtatccatcatcacgtatggctacatggttcaagaaagtctggcagct
gctgatgaactggctaaggaaggcatcaacgctgaagtcgttgacctgcgtacgctggca
ccgcttgatgaagatacgattctggaatccgttaagaagacgggccgcgtcgtattggtt
caagaagctcaaaagcaagccggcgttggtggtcaggtagcctcgctgatcggtgaaaaa
ggcattttgtacctggatgcaccaattgcgcgggtagctgcgccagacacgccatatcca
ttcagtgatgcggaagaagtatggctgcctaacaagcaagatatcgttgacaaggtcaag
gaaaccgtcaacttttaa

DBGET integrated database retrieval system