KEGG   Lactobacillus mucosae: LBLM1_05100
Entry
LBLM1_05100       CDS       T03814                                 

Definition
(GenBank) dienelactone hydrolase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lmu  Lactobacillus mucosae
Pathway
lmu00010  Glycolysis / Gluconeogenesis
lmu00020  Citrate cycle (TCA cycle)
lmu00620  Pyruvate metabolism
lmu01100  Metabolic pathways
lmu01110  Biosynthesis of secondary metabolites
lmu01120  Microbial metabolism in diverse environments
lmu01200  Carbon metabolism
Module
lmu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBLM1_05100
   00020 Citrate cycle (TCA cycle)
    LBLM1_05100
   00620 Pyruvate metabolism
    LBLM1_05100
Enzymes [BR:lmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LBLM1_05100
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_3 HlyD_D23
Other DBs
NCBI-ProteinID: AJT50482
UniProt: A0A0D4CJZ5
LinkDB
Position
1099320..1100651
AA seq 443 aa
MSKYEFKMPELGEGMAEGTIGEWHVKVGDTIQKDADMVEIENDKSTSEIPSPVDGKVTKI
NFEKGDDVTVGQVLIEFEVADGQGNVDASAEAESDASAAPEPSAAPAPSTASAAPASAPA
APAPVAAPSAADHSLPVLAMPAVRRYAREKGADLAQIAGTGRHGQILKTDVDAFLAGGAK
AAPAAAEPEAPQTAGAVAIEQPALPKGSAEWPLHDEKMTPVRKATAKAMIRSVQQIPMIH
VFDDVVVDKLWDHRKKYKELAKEHGVHLTFMAYLTKALAVIMKEYPIFNSMVDMADQKIV
YRDYINVGIATDTDRGLFVPNVKHADSMSLFDIARQISANTEKAKEGKLSGDDMSHTGMS
ITNIGSIGGGFFTPIINWPEVAILGMGRIVEEPVVVDHEIKVAKVLKLSLACDHRVIDGG
TAQRAMNRLKELLSDPELLLMEG
NT seq 1332 nt   +upstreamnt  +downstreamnt
atgagcaaatatgaattcaaaatgccagaacttggcgaagggatggcagaaggcacgatt
ggcgaatggcacgttaaggttggcgacaccattcaaaaagacgccgatatggttgaaatc
gaaaacgacaagtcaacctctgaaattccatcaccagtcgatggcaaggtaaccaaaatc
aattttgaaaagggcgacgatgttacggttggccaagtgctgatcgaatttgaggtagct
gatggtcaaggtaacgttgatgccagtgccgaagcggaaagtgatgccagtgctgctccg
gagccaagtgccgcaccagcaccaagcactgcttcagctgccccagcatcagcgccagcc
gctcctgctccagtggctgctcctagtgctgccgaccactccctgccagtcctggcaatg
ccagccgtacgtcgctatgcacgtgaaaaaggtgctgacctggctcagattgccggaacc
ggtcgtcatggccagattctaaagactgacgttgacgccttcttggctggcggtgccaag
gctgccccagctgctgctgaaccagaagctcctcaaacggcaggtgcggttgccattgaa
cagccagcactgccaaagggttccgctgaatggccactacacgatgaaaagatgacgcca
gttcgcaaggcgacggctaaggcaatgatccgttccgtacagcagattccaatgattcat
gtctttgatgacgtggtggttgacaagctttgggatcaccgcaagaagtacaaggaactg
gctaaagagcatggcgttcacctgacgtttatggcctacctgaccaaggcgctggccgta
atcatgaaggaatacccaatctttaactcgatggtggacatggctgaccaaaagatcgtc
taccgtgactacatcaacgttggtattgctacggacacggatcgcggtttgttcgtacca
aacgttaagcatgctgattctatgagtctgtttgacattgcgcgtcaaatcagcgccaat
accgaaaaggctaaggaaggcaagctttctggcgatgacatgagccacactggcatgtcg
atcaccaatatcggctcaattggcggcggcttctttacgccaatcatcaactggccggaa
gtagctatcctgggtatgggacgcattgttgaagaaccagtcgttgttgatcacgaaatc
aaggttgccaaggtcttgaagctgtcgctggcctgcgatcaccgggtaattgacggtggt
acggcacagcgggcaatgaaccggctcaaggaattgttgagtgatccagaactgttattg
atggaagggtga

DBGET integrated database retrieval system