KEGG   Lactobacillus mucosae: LBLM1_05105
Entry
LBLM1_05105       CDS       T03814                                 

Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
lmu  Lactobacillus mucosae
Pathway
lmu00010  Glycolysis / Gluconeogenesis
lmu00020  Citrate cycle (TCA cycle)
lmu00260  Glycine, serine and threonine metabolism
lmu00280  Valine, leucine and isoleucine degradation
lmu00310  Lysine degradation
lmu00380  Tryptophan metabolism
lmu00620  Pyruvate metabolism
lmu00630  Glyoxylate and dicarboxylate metabolism
lmu00640  Propanoate metabolism
lmu01100  Metabolic pathways
lmu01110  Biosynthesis of secondary metabolites
lmu01120  Microbial metabolism in diverse environments
lmu01200  Carbon metabolism
lmu01240  Biosynthesis of cofactors
Module
lmu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBLM1_05105
   00020 Citrate cycle (TCA cycle)
    LBLM1_05105
   00620 Pyruvate metabolism
    LBLM1_05105
   00630 Glyoxylate and dicarboxylate metabolism
    LBLM1_05105
   00640 Propanoate metabolism
    LBLM1_05105
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LBLM1_05105
   00280 Valine, leucine and isoleucine degradation
    LBLM1_05105
   00310 Lysine degradation
    LBLM1_05105
   00380 Tryptophan metabolism
    LBLM1_05105
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lmu04147]
    LBLM1_05105
Enzymes [BR:lmu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     LBLM1_05105
Exosome [BR:lmu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   LBLM1_05105
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 GIDA FAD_oxidored HI0933_like FAD_binding_2 DAO NAD_binding_8 FAD_binding_3 NAD_binding_7 3HCDH_N 2-Hacid_dh_C AlaDh_PNT_C Thi4 DFP XdhC_C NAD_binding_9
Other DBs
NCBI-ProteinID: AJT50483
UniProt: A0A0D4CK35
LinkDB
Position
1100658..1102061
AA seq 467 aa
MVVGDFAIDLDTIVVGAGPGGYVAAVHAAEMGQKVAVVESTYLGGVCLNVGCIPSKALIQ
VGHNYQTAKNSADQGIEVADAKLDFEKVQAFKNSVVKRMTNGVGFLFKEHKIDVINGTAY
LKNDHSLRVISGQHGQTYTFKHLILAMGSHPIEIPGFKFEGRVLDSTGALALKEVPKELV
IIGGGYIGSELANAYANFGAHVTILEGTKSILGNYEPDLVKVALKDFKAKGIDVITNAMA
KQAEQTADGVKVTYAVGDQEHTVDADYVVVSVGRRPNTKDMGLEQAGIKLDKRGLIEVDA
QGRTSVKNIFAIGDIVAGAALAHKASYEGKVAAEAISGKPTTVDYHAMPAVCYLDNEIAT
TGLTESEAKEKGLDVKTAKFPFMANGRAVSMKATEGFVRLVFMKDTHVMVGAQIVGPDAS
DLISELTLAIESGNEIDDIALTIHPHPTLSETLMDAADVGLGMPTNI
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggttgttggtgattttgcaattgatttggataccatcgtagttggcgcgggccctggc
ggttatgttgctgccgttcacgctgctgaaatgggacaaaaggttgccgtagtagaaagt
acctatcttggcggcgtttgcttaaatgttggctgtattccatcaaaagccttgattcag
gttggtcataactaccaaactgccaaaaattcagccgatcaaggcattgaggttgctgat
gccaagctcgattttgaaaaggttcaggcatttaagaacagcgtcgttaagcgtatgacc
aatggggttggcttcttgttcaaggaacacaagattgatgtaatcaacggaacggcctac
cttaaaaatgatcacagtctgcgggttatcagcggtcagcatggtcaaacctatacgttc
aagcatttgattctggcaatgggcagtcatccaattgagattcctggctttaagtttgaa
ggccgcgttctggattcaacgggtgcattggcattaaaagaagtaccaaaagaattggtc
atcattggcggcggctacattggcagcgagctggccaatgcctatgccaactttggtgcc
cacgttacgattctggaaggtaccaagtcaattctgggcaactatgagccagacttggtc
aaggttgcactcaaagactttaaggccaagggaattgacgtaattaccaatgcgatggcc
aagcaggctgaacaaaccgcagatggcgtcaaggttacctatgccgttggtgaccaagaa
cacactgtagatgccgattatgtagttgtttcggttggtcggcgtcccaacactaaagac
atgggccttgaacaagccggtatcaagcttgacaaacgcggcttaattgaagtagatgca
cagggtcggaccagcgtcaagaatatcttcgcaattggcgatatcgttgctggagcagct
ttggcacacaaggccagctatgaaggcaaggttgctgccgaagcaatctctggcaagcca
acaaccgtcgactaccacgcaatgccagcggtctgctatcttgacaatgagattgccacg
acggggctgactgaatctgaggcaaaagaaaagggattggacgtcaagactgccaagttc
ccattcatggctaatggtcgggccgtatccatgaaggcaacggaaggctttgttcggttg
gtatttatgaaggacacgcatgtcatggtcggtgctcagatcgtggggccggatgcttct
gatctgatcagtgagctgactttggcaatcgaatcaggaaatgagattgatgacattgca
ttgacgattcatccgcacccaactctttcagagacattgatggatgctgccgatgtcggc
cttggaatgccaaccaatatttaa

DBGET integrated database retrieval system