KEGG   Lactobacillus mucosae: LBLM1_06270
Entry
LBLM1_06270       CDS       T03814                                 

Definition
(GenBank) 3-hydroxybutyryl-CoA dehydrogenase
  KO
K00074  3-hydroxybutyryl-CoA dehydrogenase [EC:1.1.1.157]
Organism
lmu  Lactobacillus mucosae
Pathway
lmu00360  Phenylalanine metabolism
lmu00362  Benzoate degradation
lmu00650  Butanoate metabolism
lmu01100  Metabolic pathways
lmu01120  Microbial metabolism in diverse environments
lmu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LBLM1_06270
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    LBLM1_06270
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LBLM1_06270
Enzymes [BR:lmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.157  3-hydroxybutyryl-CoA dehydrogenase
     LBLM1_06270
SSDB
Motif
Pfam: 3HCDH_N 3HCDH NAD_Gly3P_dh_N NAD_binding_2 Beach F420_oxidored 2-Hacid_dh_C NAD_binding_7 AlaDh_PNT_C
Other DBs
NCBI-ProteinID: AJT50659
UniProt: A0A0D4CKT0
LinkDB
Position
complement(1341923..1342804)
AA seq 293 aa
MSIKNVTIAGAGTLGSQIAYQSALCGYQVRIWNPHPERAEKRIAALRPFYKHDLKLTDEQ
FDAGLKNIVSITNDWETSFKDADLVIEAVPENLDMKKDFYAQLCSVLPKEAIIASNSSTY
VPSQLVQLVDRPEKFLHLHFANHIWVFNTAEIVGNAKTDPAVIQEVVAFAKGIKMLPIVL
KKEQHGYIMNALSVPFLNAALGLWGKGVADPITIDKDWMNSTGSPMGPFMSMDVIGLRTV
WAIFSSHADTPEQKAIADKLKAMIDAGHYGVEAGEGFYTYPHPAYEDPNFLKE
NT seq 882 nt   +upstreamnt  +downstreamnt
atgtcaattaaaaacgtaacgattgccggggccggaacgctgggcagtcagattgcctat
caaagtgcgctgtgcggctatcaggttcgcatctggaatccgcatccagaacgggccgaa
aaacgaattgcggcgctgcggccattttataagcatgacctaaagctgaccgatgaacag
tttgatgccggtttgaaaaatatcgtttcgattaccaatgattgggaaacgtcatttaag
gatgccgatctggtaattgaagccgtaccagaaaatctggacatgaaaaaggatttctac
gcgcagctctgctcggtcctgccaaaagaagcaatcattgccagcaattcatcgacctac
gtgccaagtcagctggttcaactggtcgatcggccggaaaagttcttgcatctgcacttt
gccaaccatatctgggtcttcaatacggctgagatcgttggcaatgccaagaccgatccc
gcagtaattcaagaagtcgtggcttttgccaagggaatcaagatgctgccgattgttttg
aaaaaagaacaacacggctacatcatgaacgcgctgtccgtaccattcttaaacgcagcg
ctgggcctttggggaaagggcgtggctgacccgatcacgattgacaaggactggatgaat
tcaaccggttcgccaatgggaccatttatgtcaatggacgtgattggtctgcggacggtt
tgggcaattttcagttctcatgctgatacgccagagcaaaaagcaatcgccgacaaactg
aaggccatgatcgatgccggtcactatggcgtcgaggccggtgaaggattttatacctat
ccgcacccggcttatgaggatcccaacttcttaaaagaataa

DBGET integrated database retrieval system